BLASTX nr result
ID: Rehmannia28_contig00022396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022396 (831 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partia... 208 6e-65 ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containi... 209 4e-58 gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] 137 7e-33 emb|CDP19762.1| unnamed protein product [Coffea canephora] 133 1e-31 ref|XP_009628319.1| PREDICTED: pentatricopeptide repeat-containi... 132 2e-31 ref|XP_009802105.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-30 ref|XP_015161687.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-29 ref|XP_010318670.1| PREDICTED: pentatricopeptide repeat-containi... 126 3e-29 ref|XP_015070201.1| PREDICTED: pentatricopeptide repeat-containi... 126 4e-29 ref|XP_011040265.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-17 ref|XP_011040263.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-17 gb|KDP22543.1| hypothetical protein JCGZ_26374 [Jatropha curcas] 90 9e-17 ref|XP_012090594.1| PREDICTED: pentatricopeptide repeat-containi... 90 9e-17 ref|XP_015580769.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-16 ref|XP_002321748.2| pentatricopeptide repeat-containing family p... 89 3e-16 ref|XP_015900749.1| PREDICTED: pentatricopeptide repeat-containi... 81 4e-15 gb|ALP06205.1| pentatricopeptide repeat protein [Gossypium hirsu... 82 4e-14 ref|XP_006481364.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 ref|XP_006481363.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 ref|XP_006481360.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 >gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partial [Erythranthe guttata] Length = 142 Score = 208 bits (529), Expect = 6e-65 Identities = 98/138 (71%), Positives = 119/138 (86%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EV+YRL+IDA HEDGNLE+ K WNEL+DKGVLRGKVSEILV WCGNGDISEVL+L++K Sbjct: 6 EVIYRLMIDALHEDGNLEEGFKKWNELLDKGVLRGKVSEILVTVWCGNGDISEVLSLIEK 65 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGDF 472 +GYKPSV+TCGTLAYGLKRVGYK E+DKV+D MVRFGW+P S+SLN+LI QYQRG+ Sbjct: 66 TGVEGYKPSVATCGTLAYGLKRVGYK-EVDKVLDVMVRFGWVPPSMSLNDLIGQYQRGNL 124 Query: 471 ESRSDCCKEAAPEVACQV 418 +S+++ AA E+ACQ+ Sbjct: 125 DSKNEVSGLAANEIACQI 142 >ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] Length = 1035 Score = 209 bits (532), Expect = 4e-58 Identities = 101/139 (72%), Positives = 116/139 (83%), Gaps = 1/139 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EV YRL++DA++EDGNLEKA WNEL+ KGVL+GKVSEIL+GAWCGNGDIS VLA LDK Sbjct: 897 EVAYRLMLDAFYEDGNLEKAFTVWNELLGKGVLKGKVSEILIGAWCGNGDISGVLASLDK 956 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYK-DELDKVVDFMVRFGWIPASLSLNELISQYQRGD 475 +R+QGYKPSV+TCGTLAYGLKR+GYK +ELDKV D MV FGW+P+SLSLN+LI QYQ GD Sbjct: 957 IREQGYKPSVTTCGTLAYGLKRIGYKEEELDKVFDVMVSFGWVPSSLSLNDLIIQYQPGD 1016 Query: 474 FESRSDCCKEAAPEVACQV 418 E SD A EV CQV Sbjct: 1017 LEIGSDQSMRAVSEVVCQV 1035 >gb|EPS65114.1| hypothetical protein M569_09664 [Genlisea aurea] Length = 1012 Score = 137 bits (344), Expect = 7e-33 Identities = 66/113 (58%), Positives = 88/113 (77%), Gaps = 1/113 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 E++YRL+IDAY EDGN KA++ WNEL+D GVL+GKVSE+LVGAW NGD+S+V+ LL Sbjct: 889 EIMYRLMIDAYSEDGNPTKALQAWNELLDSGVLKGKVSEMLVGAWRRNGDVSQVVELLGG 948 Query: 651 MRDQGY-KPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELI 496 M+ +GY P+ ++C L YGLKR G +E+DKV D MV FGW+P+ SLN+L+ Sbjct: 949 MKREGYTPPTANSCSILLYGLKRFGC-EEVDKVYDSMVSFGWVPSVSSLNDLL 1000 >emb|CDP19762.1| unnamed protein product [Coffea canephora] Length = 1035 Score = 133 bits (335), Expect = 1e-31 Identities = 65/139 (46%), Positives = 93/139 (66%), Gaps = 1/139 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 E++Y ++I AY ++G+LEK K W+ +DKG+L G +E LV GNG+IS V+ LLD+ Sbjct: 897 ELIYSMMIGAYFKEGHLEKGFKLWDLALDKGLLDGLTNETLVETLSGNGEISRVMELLDR 956 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQ-RGD 475 + +QGY P ++ C TL +GL + GY LDK+++ M +GWIP +LNE I YQ + Sbjct: 957 IGNQGYNPCLAMCSTLIHGLNKAGYSRRLDKILEIMKGYGWIPKCTALNEFIDLYQISAN 1016 Query: 474 FESRSDCCKEAAPEVACQV 418 ES S+ K+AA EVACQV Sbjct: 1017 SESVSNLSKQAALEVACQV 1035 >ref|XP_009628319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tomentosiformis] gi|697148280|ref|XP_009628320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana tomentosiformis] Length = 921 Score = 132 bits (333), Expect = 2e-31 Identities = 67/138 (48%), Positives = 97/138 (70%), Gaps = 1/138 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EVVY ++DA + +GNL KA WNEL+DKG+L+G VSE LV +WC G+IS +LA L++ Sbjct: 783 EVVYSSMVDALYREGNLHKAFSLWNELLDKGLLKGHVSETLVQSWCEKGEISALLASLNE 842 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQR-GD 475 + +QG+ PS++ C TLA GL + GY ++L ++ MV+F WI SL+ N+LI++ Q G Sbjct: 843 IGEQGFVPSLAMCSTLAQGLDKAGYSEKLPMALETMVKFSWISNSLTSNDLITRCQMDGH 902 Query: 474 FESRSDCCKEAAPEVACQ 421 ES S+ K++A EVA Q Sbjct: 903 TESVSNPPKQSAFEVALQ 920 >ref|XP_009802105.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana sylvestris] Length = 921 Score = 130 bits (327), Expect = 1e-30 Identities = 65/138 (47%), Positives = 96/138 (69%), Gaps = 1/138 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EVVY ++DA + +GNL KA WNEL+DKG+L+G VSE LV +WC G+IS +LA L++ Sbjct: 783 EVVYSSMVDALYREGNLHKAFSLWNELLDKGLLKGHVSETLVQSWCEKGEISALLASLNE 842 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQR-GD 475 + +QG+ PS++ C TLA GL + GY ++L ++ MV+F WI S++ +LI++ Q G Sbjct: 843 IGEQGFVPSIAMCSTLAQGLDKAGYSEKLPMALETMVKFSWISNSMTSTDLITRCQMDGH 902 Query: 474 FESRSDCCKEAAPEVACQ 421 ES S+ K++A EVA Q Sbjct: 903 TESVSNPPKQSAFEVALQ 920 >ref|XP_015161687.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum tuberosum] Length = 1035 Score = 127 bits (319), Expect = 1e-29 Identities = 62/132 (46%), Positives = 92/132 (69%), Gaps = 1/132 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EVVY ++DA + +GNL KA WNEL+DKG+L+G VSE LVG+WC G+IS +LA L++ Sbjct: 903 EVVYSSMVDALYREGNLHKAFSLWNELLDKGLLKGHVSETLVGSWCEKGEISALLASLNE 962 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGDF 472 + +QG+ P ++ C TLA+GL + GY + L V++ MV+F WI S++ N+LI Q + Sbjct: 963 IGEQGFVPGLAMCSTLAHGLNQAGYSEILPMVMETMVKFSWISNSMTSNDLIRHCQIDEH 1022 Query: 471 -ESRSDCCKEAA 439 ES S+ K++A Sbjct: 1023 TESISNTPKQSA 1034 >ref|XP_010318670.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum lycopersicum] gi|723686005|ref|XP_004236435.2| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum lycopersicum] Length = 1035 Score = 126 bits (317), Expect = 3e-29 Identities = 63/132 (47%), Positives = 91/132 (68%), Gaps = 1/132 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EVVY ++DA + +GNL KA WNEL+DKG+L+G VSE LVG+WC G+IS +LA L++ Sbjct: 903 EVVYSSMVDALYREGNLHKAFSLWNELLDKGLLKGHVSETLVGSWCEKGEISALLASLNE 962 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGDF 472 + QG+ PS++ C TLA+GL + GY + L V+ MV+F WI S++ N+LI Q + Sbjct: 963 IGAQGFVPSLAMCSTLAHGLNQAGYSEILPMFVETMVKFSWISNSMTSNDLIRHCQIDEH 1022 Query: 471 -ESRSDCCKEAA 439 ES S+ K++A Sbjct: 1023 TESISNTPKQSA 1034 >ref|XP_015070201.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum pennellii] gi|970018093|ref|XP_015070202.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum pennellii] gi|970018095|ref|XP_015070203.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Solanum pennellii] Length = 1035 Score = 126 bits (316), Expect = 4e-29 Identities = 63/132 (47%), Positives = 91/132 (68%), Gaps = 1/132 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGKVSEILVGAWCGNGDISEVLALLDK 652 EVVY ++DA + +GNL KA WNEL+DKG+L+G VSE LVG+WC G+IS +LA L++ Sbjct: 903 EVVYSSMVDALYREGNLHKAFSLWNELLDKGLLKGHVSESLVGSWCEKGEISALLASLNE 962 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGDF 472 + QG+ PS++ C TLA+GL + GY + L V+ MV+F WI S++ N+LI Q + Sbjct: 963 IGAQGFVPSLAMCSTLAHGLNQAGYSEILPMFVETMVKFSWISNSMTSNDLIRHCQIDEH 1022 Query: 471 -ESRSDCCKEAA 439 ES S+ K++A Sbjct: 1023 TESISNSPKQSA 1034 >ref|XP_011040265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X2 [Populus euphratica] Length = 803 Score = 92.0 bits (227), Expect = 2e-17 Identities = 53/139 (38%), Positives = 82/139 (58%), Gaps = 2/139 (1%) Frame = -1 Query: 828 VVYRLIIDAYHEDGNLEKAIKTWNELMDKGV-LRGKVSEILVGAWCGNGDISEVLALLDK 652 V + ++IDA+ ++G+ K +K ++++ KG L V +L+ A C ISEVL +L+K Sbjct: 663 VTWSVMIDAHLKEGDHVKTLKLVDDMLKKGGNLSKNVCHVLIDALCRKEHISEVLKVLEK 722 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRG-D 475 + +QG S++TC L + G D +V+ MVRF W+P S LN+LI++ Q D Sbjct: 723 IEEQGLNLSLATCSALVRCFHKAGKMDSAARVLKSMVRFKWVPDSTGLNDLINEEQGSTD 782 Query: 474 FESRSDCCKEAAPEVACQV 418 E+ D K+ A EVACQV Sbjct: 783 SENAGDFLKQMAWEVACQV 801 >ref|XP_011040263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X1 [Populus euphratica] gi|743894037|ref|XP_011040264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X1 [Populus euphratica] Length = 1041 Score = 92.0 bits (227), Expect = 2e-17 Identities = 53/139 (38%), Positives = 82/139 (58%), Gaps = 2/139 (1%) Frame = -1 Query: 828 VVYRLIIDAYHEDGNLEKAIKTWNELMDKGV-LRGKVSEILVGAWCGNGDISEVLALLDK 652 V + ++IDA+ ++G+ K +K ++++ KG L V +L+ A C ISEVL +L+K Sbjct: 901 VTWSVMIDAHLKEGDHVKTLKLVDDMLKKGGNLSKNVCHVLIDALCRKEHISEVLKVLEK 960 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRG-D 475 + +QG S++TC L + G D +V+ MVRF W+P S LN+LI++ Q D Sbjct: 961 IEEQGLNLSLATCSALVRCFHKAGKMDSAARVLKSMVRFKWVPDSTGLNDLINEEQGSTD 1020 Query: 474 FESRSDCCKEAAPEVACQV 418 E+ D K+ A EVACQV Sbjct: 1021 SENAGDFLKQMAWEVACQV 1039 >gb|KDP22543.1| hypothetical protein JCGZ_26374 [Jatropha curcas] Length = 895 Score = 90.1 bits (222), Expect = 9e-17 Identities = 48/138 (34%), Positives = 84/138 (60%), Gaps = 1/138 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGK-VSEILVGAWCGNGDISEVLALLD 655 ++++ ++IDAY ++GN KA+K ++++ K V GK V +L C ++ ++L LL+ Sbjct: 756 DMLWSVMIDAYLQEGNWIKALKLVDDILLKDVNVGKNVYNVLTDILCTYNNVPKLLKLLN 815 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGD 475 ++ +QGY +++TC L R G DE KV+D MVRFGW+PAS + + I++ + Sbjct: 816 EIEEQGYNLNLATCRVLVCCFHRAGRTDEAVKVLDRMVRFGWVPASTDICDFINEDSKKS 875 Query: 474 FESRSDCCKEAAPEVACQ 421 ++ D K+ P +ACQ Sbjct: 876 -DNIDDFSKQTVPGIACQ 892 >ref|XP_012090594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Jatropha curcas] gi|802770324|ref|XP_012090595.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Jatropha curcas] gi|802770328|ref|XP_012090596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Jatropha curcas] Length = 1030 Score = 90.1 bits (222), Expect = 9e-17 Identities = 48/138 (34%), Positives = 84/138 (60%), Gaps = 1/138 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGK-VSEILVGAWCGNGDISEVLALLD 655 ++++ ++IDAY ++GN KA+K ++++ K V GK V +L C ++ ++L LL+ Sbjct: 891 DMLWSVMIDAYLQEGNWIKALKLVDDILLKDVNVGKNVYNVLTDILCTYNNVPKLLKLLN 950 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGD 475 ++ +QGY +++TC L R G DE KV+D MVRFGW+PAS + + I++ + Sbjct: 951 EIEEQGYNLNLATCRVLVCCFHRAGRTDEAVKVLDRMVRFGWVPASTDICDFINEDSKKS 1010 Query: 474 FESRSDCCKEAAPEVACQ 421 ++ D K+ P +ACQ Sbjct: 1011 -DNIDDFSKQTVPGIACQ 1027 >ref|XP_015580769.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Ricinus communis] gi|1000985195|ref|XP_015580774.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Ricinus communis] gi|1000985197|ref|XP_015580781.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Ricinus communis] Length = 1037 Score = 89.7 bits (221), Expect = 1e-16 Identities = 51/139 (36%), Positives = 85/139 (61%), Gaps = 2/139 (1%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGK-VSEILVGAWCGNGDISEVLALLD 655 ++ + +++DA+ ++GN KA+K ++++ +GV K + IL+ A C + ++SEVL +LD Sbjct: 896 DLAWSVMVDAHLKEGNWIKALKLVDDMLSEGVNVCKNLYTILIDALCKHNNLSEVLKVLD 955 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQR-G 478 ++ QG K S++TCGTL R G DE +V++ MVRF W+P S L++LI++ Q Sbjct: 956 EVEKQGSKLSLATCGTLVCCFHRAGRTDEALRVLESMVRFTWVPNSTVLSDLINENQDIA 1015 Query: 477 DFESRSDCCKEAAPEVACQ 421 + E D K ACQ Sbjct: 1016 NSEIADDFLKRTTTGAACQ 1034 >ref|XP_002321748.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550322507|gb|EEF05875.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1026 Score = 88.6 bits (218), Expect = 3e-16 Identities = 52/139 (37%), Positives = 81/139 (58%), Gaps = 2/139 (1%) Frame = -1 Query: 828 VVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGK-VSEILVGAWCGNGDISEVLALLDK 652 V + ++IDA+ ++G+ K +K ++++ KG K V +L+ C +SEVL +L+K Sbjct: 886 VTWSVMIDAHLKEGDHVKTLKLVDDMLKKGGNVSKNVCHVLIDPLCRKEHVSEVLKVLEK 945 Query: 651 MRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRG-D 475 + +QG S++TC TL + G D +V+ MVRF W+P S LN+LI+ Q D Sbjct: 946 IEEQGLNLSLATCSTLVRCFHKAGKMDGAARVLKSMVRFKWVPDSTELNDLINVEQDSTD 1005 Query: 474 FESRSDCCKEAAPEVACQV 418 E+ D K+ A EVACQV Sbjct: 1006 SENAGDFLKQMAWEVACQV 1024 >ref|XP_015900749.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Ziziphus jujuba] Length = 189 Score = 81.3 bits (199), Expect = 4e-15 Identities = 45/126 (35%), Positives = 75/126 (59%), Gaps = 1/126 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGV-LRGKVSEILVGAWCGNGDISEVLALLD 655 +V Y +IIDA ++ N+ +A+K +E++ KG+ L E L+ A C + E L LL+ Sbjct: 55 KVTYSVIIDALCKEENIMEALKLRDEMLKKGIPLNLGTYESLIQALCDKEEFLEALKLLN 114 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELISQYQRGD 475 +M G+KPS++TC +A G +R G D+ +V++ ++ FGW+ S SL++LI Q+ Sbjct: 115 EMGYGGFKPSLATCSIIASGFQRAGNMDKAAEVLERVMWFGWVSDSTSLSDLIDGNQKDA 174 Query: 474 FESRSD 457 SD Sbjct: 175 NSENSD 180 >gb|ALP06205.1| pentatricopeptide repeat protein [Gossypium hirsutum] Length = 1023 Score = 82.4 bits (202), Expect = 4e-14 Identities = 49/140 (35%), Positives = 83/140 (59%), Gaps = 2/140 (1%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVLRGK-VSEILVGAWCGNGDISEVLALLD 655 E++YRLI +AY E+ +L +K +E++ K V+ K + +L+ A C + SEV L+ Sbjct: 884 EIIYRLIANAYLEENSLIGMLKLLDEILVKDVVFDKNPTFLLLDAVCKREEFSEVPKSLE 943 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNELI-SQYQRG 478 +M +QG K S TC L +G G ++ + +++ +VRFGWIP + ++N +I + Sbjct: 944 EMAEQGLKLSPITCHKLVHGFHDKGNPEKAEWILESLVRFGWIPNTTTVNSIIDKENDVA 1003 Query: 477 DFESRSDCCKEAAPEVACQV 418 + ES ++ K+A VACQV Sbjct: 1004 NLESPNNSPKQATCGVACQV 1023 >ref|XP_006481364.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X3 [Citrus sinensis] Length = 1018 Score = 81.6 bits (200), Expect = 7e-14 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 1/111 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVL-RGKVSEILVGAWCGNGDISEVLALLD 655 E Y ++IDA+ ++ NL +A K +E++ KG+L +G + L+ A C GD+SEV LL+ Sbjct: 886 EAAYDIVIDAHCKNDNLTEAFKLRDEMLRKGLLSKGSAYDSLIDALCKKGDLSEVSKLLE 945 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNE 502 +M+ KP +STC L + G DE K+ M+ GW+P SL+E Sbjct: 946 EMKQHEVKPCLSTCSGLLNSFHKAGEIDEAAKIFRSMINNGWVPDDSSLSE 996 >ref|XP_006481363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1018 Score = 81.6 bits (200), Expect = 7e-14 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 1/111 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVL-RGKVSEILVGAWCGNGDISEVLALLD 655 E Y ++IDA+ ++ NL +A K +E++ KG+L +G + L+ A C GD+SEV LL+ Sbjct: 886 EAAYDIVIDAHCKNDNLTEAFKLRDEMLRKGLLSKGSAYDSLIDALCKKGDLSEVSKLLE 945 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNE 502 +M+ KP +STC L + G DE K+ M+ GW+P SL+E Sbjct: 946 EMKQHEVKPCLSTCSGLLNSFHKAGEIDEAAKIFRSMINNGWVPDDSSLSE 996 >ref|XP_006481360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X1 [Citrus sinensis] gi|568855538|ref|XP_006481361.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X1 [Citrus sinensis] gi|568855540|ref|XP_006481362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X1 [Citrus sinensis] Length = 1181 Score = 81.6 bits (200), Expect = 7e-14 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 1/111 (0%) Frame = -1 Query: 831 EVVYRLIIDAYHEDGNLEKAIKTWNELMDKGVL-RGKVSEILVGAWCGNGDISEVLALLD 655 E Y ++IDA+ ++ NL +A K +E++ KG+L +G + L+ A C GD+SEV LL+ Sbjct: 1049 EAAYDIVIDAHCKNDNLTEAFKLRDEMLRKGLLSKGSAYDSLIDALCKKGDLSEVSKLLE 1108 Query: 654 KMRDQGYKPSVSTCGTLAYGLKRVGYKDELDKVVDFMVRFGWIPASLSLNE 502 +M+ KP +STC L + G DE K+ M+ GW+P SL+E Sbjct: 1109 EMKQHEVKPCLSTCSGLLNSFHKAGEIDEAAKIFRSMINNGWVPDDSSLSE 1159