BLASTX nr result
ID: Rehmannia28_contig00022379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022379 (2126 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092924.1| PREDICTED: calcium-dependent protein kinase ... 57 3e-10 ref|XP_012833794.1| PREDICTED: calcium-dependent protein kinase ... 57 1e-09 gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Erythra... 57 1e-09 gb|KJB31960.1| hypothetical protein B456_005G216500 [Gossypium r... 54 1e-09 ref|XP_010645740.1| PREDICTED: calcium-dependent protein kinase ... 54 1e-09 ref|XP_015972855.1| PREDICTED: calcium-dependent protein kinase ... 54 1e-09 emb|CAN78387.1| hypothetical protein VITISV_017368 [Vitis vinifera] 54 1e-09 gb|AKO82460.1| calcium-dependent protein kinase 2 [Vitis pseudor... 54 1e-09 gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amuren... 54 1e-09 ref|XP_002282994.1| PREDICTED: calcium-dependent protein kinase ... 54 1e-09 ref|XP_003618125.1| calmodulin-domain kinase CDPK protein [Medic... 54 1e-09 ref|XP_003618126.2| calmodulin-domain kinase CDPK protein [Medic... 54 1e-09 emb|CBI37730.3| unnamed protein product [Vitis vinifera] 54 1e-09 ref|XP_010645765.1| PREDICTED: calcium-dependent protein kinase ... 54 1e-09 ref|XP_008348947.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 54 2e-09 ref|XP_009340796.1| PREDICTED: calcium-dependent protein kinase ... 54 2e-09 ref|XP_012568715.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 54 2e-09 ref|XP_006412116.1| hypothetical protein EUTSA_v10024803mg [Eutr... 51 2e-09 ref|XP_013751938.1| PREDICTED: calcium-dependent protein kinase ... 51 2e-09 ref|XP_009103017.1| PREDICTED: calcium-dependent protein kinase ... 51 2e-09 >ref|XP_011092924.1| PREDICTED: calcium-dependent protein kinase 4-like [Sesamum indicum] gi|747090467|ref|XP_011092925.1| PREDICTED: calcium-dependent protein kinase 4-like [Sesamum indicum] Length = 567 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A +HLNKLE E+HLW AAF Sbjct: 454 DVDNSGTIDYGEFIAATIHLNKLEREEHLW--AAF 486 Score = 38.1 bits (87), Expect(2) = 3e-10 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QACV H +T V ++DIIKEVDQ N Sbjct: 496 YITVDELQQACVEHGMTDVLLEDIIKEVDQDN 527 >ref|XP_012833794.1| PREDICTED: calcium-dependent protein kinase 26 [Erythranthe guttata] gi|848866226|ref|XP_012833795.1| PREDICTED: calcium-dependent protein kinase 26 [Erythranthe guttata] Length = 558 Score = 57.0 bits (136), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A +HLNKLE E+HLW AAF Sbjct: 445 DVDNSGTIDYGEFIAATIHLNKLEREEHLW--AAF 477 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T F++DII+EVDQ N Sbjct: 487 YITVDELQQACAEHGMTDAFLEDIIREVDQDN 518 >gb|EYU40484.1| hypothetical protein MIMGU_mgv1a004107mg [Erythranthe guttata] Length = 543 Score = 57.0 bits (136), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A +HLNKLE E+HLW AAF Sbjct: 430 DVDNSGTIDYGEFIAATIHLNKLEREEHLW--AAF 462 Score = 36.2 bits (82), Expect(2) = 1e-09 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T F++DII+EVDQ N Sbjct: 472 YITVDELQQACAEHGMTDAFLEDIIREVDQDN 503 >gb|KJB31960.1| hypothetical protein B456_005G216500 [Gossypium raimondii] Length = 542 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 455 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 487 Score = 39.7 bits (91), Expect(2) = 1e-09 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYNVCDS 1910 ++ V L+QAC H +T V ++DII+EVDQ N C S Sbjct: 497 YITVDELQQACAEHNMTDVLLEDIIREVDQDNECGS 532 >ref|XP_010645740.1| PREDICTED: calcium-dependent protein kinase 26 isoform X1 [Vitis vinifera] Length = 600 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 487 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 519 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 529 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 560 >ref|XP_015972855.1| PREDICTED: calcium-dependent protein kinase 26 [Arachis duranensis] gi|1012199749|ref|XP_015972856.1| PREDICTED: calcium-dependent protein kinase 26 [Arachis duranensis] Length = 563 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A +HLNKLE E+HL +AAF Sbjct: 452 DVDNSGTIDYGEFIAATIHLNKLEREEHL--IAAF 484 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC+ H +T VF++DII+EVDQ N Sbjct: 494 YITVDELQQACIEHNMTDVFLEDIIREVDQDN 525 >emb|CAN78387.1| hypothetical protein VITISV_017368 [Vitis vinifera] Length = 561 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 448 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 480 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >gb|AKO82460.1| calcium-dependent protein kinase 2 [Vitis pseudoreticulata] Length = 561 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 448 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 480 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amurensis] Length = 561 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 448 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 480 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >ref|XP_002282994.1| PREDICTED: calcium-dependent protein kinase 26 isoform X2 [Vitis vinifera] gi|731382575|ref|XP_010645751.1| PREDICTED: calcium-dependent protein kinase 26 isoform X2 [Vitis vinifera] gi|731382578|ref|XP_010645759.1| PREDICTED: calcium-dependent protein kinase 26 isoform X2 [Vitis vinifera] Length = 561 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 448 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 480 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >ref|XP_003618125.1| calmodulin-domain kinase CDPK protein [Medicago truncatula] gi|355519460|gb|AET01084.1| calmodulin-domain kinase CDPK protein [Medicago truncatula] Length = 559 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 446 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 478 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 488 YITVDELQQACTEHNMTDVFLEDIIKEVDQDN 519 >ref|XP_003618126.2| calmodulin-domain kinase CDPK protein [Medicago truncatula] gi|657386098|gb|AET01085.2| calmodulin-domain kinase CDPK protein [Medicago truncatula] Length = 487 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 374 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 406 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 416 YITVDELQQACTEHNMTDVFLEDIIKEVDQDN 447 >emb|CBI37730.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 350 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 382 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 392 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 423 >ref|XP_010645765.1| PREDICTED: calcium-dependent protein kinase 4 isoform X3 [Vitis vinifera] Length = 340 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 227 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 259 Score = 39.3 bits (90), Expect(2) = 1e-09 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 269 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 300 >ref|XP_008348947.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 26-like [Malus domestica] Length = 570 Score = 53.9 bits (128), Expect(2) = 2e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 453 DVDNSGTIDYGEFIAATVHLNKLEREEHL--IAAF 485 Score = 38.5 bits (88), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T V +DDIIKEVDQ N Sbjct: 495 YITVDELQQACTEHNMTDVLLDDIIKEVDQDN 526 >ref|XP_009340796.1| PREDICTED: calcium-dependent protein kinase 26 [Pyrus x bretschneideri] Length = 570 Score = 53.5 bits (127), Expect(2) = 2e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 453 DVDNSGTIDYGEFIAATVHLNKLEREEHL--VAAF 485 Score = 38.5 bits (88), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T V +DDIIKEVDQ N Sbjct: 495 YITVDELQQACTEHNMTDVLLDDIIKEVDQDN 526 >ref|XP_012568715.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 26 [Cicer arietinum] Length = 564 Score = 53.9 bits (128), Expect(2) = 2e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDYG+FI A VHLNKLE E+HL +AAF Sbjct: 451 DVDNSGTIDYGEFIAATVHLNKLEREEHL--IAAF 483 Score = 38.1 bits (87), Expect(2) = 2e-09 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ V L+QAC H +T VF++DII+EVDQ N Sbjct: 493 YITVDELQQACAEHNMTDVFLEDIIREVDQDN 524 >ref|XP_006412116.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|567216976|ref|XP_006412117.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|567216978|ref|XP_006412118.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113286|gb|ESQ53569.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113287|gb|ESQ53570.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113288|gb|ESQ53571.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] Length = 563 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDY +FI A +HLNKLE E+HL +AAF Sbjct: 453 DVDNSGTIDYSEFIAATIHLNKLEREEHL--VAAF 485 Score = 41.2 bits (95), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ + L+QACV H +T VF++DIIKEVDQ N Sbjct: 495 YITIDELQQACVEHSMTDVFLEDIIKEVDQNN 526 >ref|XP_013751938.1| PREDICTED: calcium-dependent protein kinase 5-like [Brassica napus] Length = 545 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDY +FI A +HLNKLE E+HL +AAF Sbjct: 436 DVDNSGTIDYSEFIAATIHLNKLEREEHL--VAAF 468 Score = 41.2 bits (95), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ + L+QACV H +T VF++DIIKEVDQ N Sbjct: 478 YITIDELQQACVEHSMTDVFLEDIIKEVDQNN 509 >ref|XP_009103017.1| PREDICTED: calcium-dependent protein kinase 5 [Brassica rapa] Length = 545 Score = 50.8 bits (120), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1693 DIDNSGTIDYGKFIIARVHLNKLESEKHLWQLAAF 1797 D+DNSGTIDY +FI A +HLNKLE E+HL +AAF Sbjct: 436 DVDNSGTIDYSEFIAATIHLNKLEREEHL--VAAF 468 Score = 41.2 bits (95), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = +3 Query: 1803 WMKVVRLEQACV*HIITSVFMDDIIKEVDQYN 1898 ++ + L+QACV H +T VF++DIIKEVDQ N Sbjct: 478 YITIDELQQACVEHSMTDVFLEDIIKEVDQNN 509