BLASTX nr result
ID: Rehmannia28_contig00022244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022244 (385 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] 54 7e-06 >emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] Length = 528 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = -3 Query: 380 GFPVGPSFCFAVPHNLHRRYSHLDCRIVVELHMPMLPVCDXXXXXXXXAH*SPHSCHGVV 201 G + PS F + +LHRR HLD R+VV++HMP+L V D A PHSC GV Sbjct: 441 GVSIRPSLRFPLSPHLHRRRRHLDRRVVVDVHMPLLLVRDGTSRACAGADQGPHSCDGVG 500 Query: 200 Y 198 Y Sbjct: 501 Y 501