BLASTX nr result
ID: Rehmannia28_contig00022186
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022186 (511 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069942.1| PREDICTED: glutaredoxin-C4 [Sesamum indicum] 113 3e-29 gb|KVI11831.1| Glutaredoxin, partial [Cynara cardunculus var. sc... 107 2e-26 ref|XP_012474170.1| PREDICTED: glutaredoxin-C4 [Gossypium raimon... 105 3e-26 ref|XP_007014498.1| Glutaredoxin C4 [Theobroma cacao] gi|5087848... 105 4e-26 emb|CDP03012.1| unnamed protein product [Coffea canephora] 104 1e-25 ref|XP_015954431.1| PREDICTED: glutaredoxin-C4 [Arachis duranensis] 103 1e-25 ref|XP_012857222.1| PREDICTED: glutaredoxin-C4 [Erythranthe gutt... 103 2e-25 gb|EPS66469.1| hypothetical protein M569_08309, partial [Genlise... 103 2e-25 gb|KMS96034.1| hypothetical protein BVRB_002630 [Beta vulgaris s... 103 3e-25 ref|XP_006474249.1| PREDICTED: glutaredoxin-C4 [Citrus sinensis] 103 3e-25 gb|KHG02683.1| Glutaredoxin-C4 -like protein [Gossypium arboreum] 102 3e-25 ref|XP_009796016.1| PREDICTED: glutaredoxin-C4 [Nicotiana sylves... 102 4e-25 gb|AFK38026.1| unknown [Medicago truncatula] 102 5e-25 ref|XP_003595130.1| glutaredoxin C4 [Medicago truncatula] gi|355... 102 5e-25 ref|XP_009619991.1| PREDICTED: glutaredoxin-C4 [Nicotiana toment... 102 5e-25 gb|AFK43763.1| unknown [Lotus japonicus] 102 5e-25 ref|XP_010048610.1| PREDICTED: glutaredoxin-C4 [Eucalyptus grand... 101 1e-24 ref|XP_015898903.1| PREDICTED: glutaredoxin-C4 [Ziziphus jujuba] 101 1e-24 ref|XP_003595129.1| glutaredoxin C4 [Medicago truncatula] gi|355... 102 1e-24 gb|AFK48169.1| unknown [Lotus japonicus] 101 1e-24 >ref|XP_011069942.1| PREDICTED: glutaredoxin-C4 [Sesamum indicum] Length = 142 Score = 113 bits (283), Expect = 3e-29 Identities = 54/63 (85%), Positives = 60/63 (95%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG +IQDALS+IVGRRTVPQVFINGKH+GGSDDT+EAYESGEL+KLLG+ T GK Sbjct: 80 ELDERDDGGEIQDALSKIVGRRTVPQVFINGKHIGGSDDTLEAYESGELQKLLGIGTGGK 139 Query: 181 EDL 189 EDL Sbjct: 140 EDL 142 >gb|KVI11831.1| Glutaredoxin, partial [Cynara cardunculus var. scolymus] Length = 173 Score = 107 bits (266), Expect = 2e-26 Identities = 52/63 (82%), Positives = 58/63 (92%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDER+DG KIQDALSE+VGRRTVPQVFINGKHLGGSDDT+EAYESG+L KLLG+D+ K Sbjct: 111 ELDEREDGWKIQDALSELVGRRTVPQVFINGKHLGGSDDTIEAYESGQLAKLLGIDSGHK 170 Query: 181 EDL 189 DL Sbjct: 171 TDL 173 >ref|XP_012474170.1| PREDICTED: glutaredoxin-C4 [Gossypium raimondii] gi|763760076|gb|KJB27407.1| hypothetical protein B456_004G096800 [Gossypium raimondii] gi|763760077|gb|KJB27408.1| hypothetical protein B456_004G096800 [Gossypium raimondii] Length = 131 Score = 105 bits (262), Expect = 3e-26 Identities = 50/63 (79%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDALSEIVGRRTVPQVFINGKH+GGSDDT+EAY+SG+L KLLG++ K Sbjct: 69 ELDERDDGWNIQDALSEIVGRRTVPQVFINGKHIGGSDDTVEAYQSGKLAKLLGIEVENK 128 Query: 181 EDL 189 +DL Sbjct: 129 DDL 131 >ref|XP_007014498.1| Glutaredoxin C4 [Theobroma cacao] gi|508784861|gb|EOY32117.1| Glutaredoxin C4 [Theobroma cacao] Length = 131 Score = 105 bits (261), Expect = 4e-26 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDALSEIVGRRTVPQVFINGKH+GGSDDT+EAY+SG+L KLLG+D K Sbjct: 69 ELDERDDGWNIQDALSEIVGRRTVPQVFINGKHIGGSDDTVEAYQSGKLAKLLGIDIKLK 128 Query: 181 EDL 189 +DL Sbjct: 129 DDL 131 >emb|CDP03012.1| unnamed protein product [Coffea canephora] Length = 150 Score = 104 bits (260), Expect = 1e-25 Identities = 50/63 (79%), Positives = 58/63 (92%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG KIQ+A+S+IVGRRTVPQVFINGKH+GGSDDT+EAYESGEL KLLG+ T + Sbjct: 88 ELDERDDGWKIQNAMSKIVGRRTVPQVFINGKHIGGSDDTVEAYESGELAKLLGITTSQR 147 Query: 181 EDL 189 +DL Sbjct: 148 DDL 150 >ref|XP_015954431.1| PREDICTED: glutaredoxin-C4 [Arachis duranensis] Length = 135 Score = 103 bits (258), Expect = 1e-25 Identities = 50/63 (79%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L+ IVGRRTVPQVFINGKHLGGSDDT+EAYESG L KLLG++T Sbjct: 73 ELDERDDGSKIQDILNNIVGRRTVPQVFINGKHLGGSDDTVEAYESGRLAKLLGIETKVH 132 Query: 181 EDL 189 +DL Sbjct: 133 DDL 135 >ref|XP_012857222.1| PREDICTED: glutaredoxin-C4 [Erythranthe guttata] gi|604301172|gb|EYU20892.1| hypothetical protein MIMGU_mgv1a015927mg [Erythranthe guttata] Length = 140 Score = 103 bits (257), Expect = 2e-25 Identities = 51/63 (80%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDER+DG +IQDALS+IVGRRTVPQVFINGKHLGGSDDT+EAYESG L KLLGL T + Sbjct: 78 ELDEREDGGEIQDALSKIVGRRTVPQVFINGKHLGGSDDTVEAYESGALAKLLGLATEEE 137 Query: 181 EDL 189 E+L Sbjct: 138 EEL 140 >gb|EPS66469.1| hypothetical protein M569_08309, partial [Genlisea aurea] Length = 128 Score = 103 bits (256), Expect = 2e-25 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDE+DDGA+IQ ALSEIVGRRTVPQVFINGKH+GGSDDT+EAYESGEL KLLG++ GK Sbjct: 70 ELDEKDDGAEIQQALSEIVGRRTVPQVFINGKHIGGSDDTVEAYESGELAKLLGIE--GK 127 Query: 181 E 183 E Sbjct: 128 E 128 >gb|KMS96034.1| hypothetical protein BVRB_002630 [Beta vulgaris subsp. vulgaris] Length = 135 Score = 103 bits (256), Expect = 3e-25 Identities = 48/63 (76%), Positives = 55/63 (87%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+ IQDAL IVGRRTVPQVFINGKH+GGSDDT+EAY++GEL KLLG+D Sbjct: 73 ELDERDDGSDIQDALKGIVGRRTVPQVFINGKHIGGSDDTLEAYQNGELAKLLGIDATNH 132 Query: 181 EDL 189 +DL Sbjct: 133 DDL 135 >ref|XP_006474249.1| PREDICTED: glutaredoxin-C4 [Citrus sinensis] Length = 139 Score = 103 bits (256), Expect = 3e-25 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDAL E+VGRRTVPQVFINGKH+GGSDDT+EAYESG+L +LLG+ GK Sbjct: 77 ELDERDDGWNIQDALGEMVGRRTVPQVFINGKHIGGSDDTVEAYESGKLAQLLGIAASGK 136 Query: 181 EDL 189 +DL Sbjct: 137 DDL 139 >gb|KHG02683.1| Glutaredoxin-C4 -like protein [Gossypium arboreum] Length = 131 Score = 102 bits (255), Expect = 3e-25 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDALSEIV RRTVPQVFINGKH+GGSDDT+EAY+SG+L KLLG++ K Sbjct: 69 ELDERDDGWNIQDALSEIVSRRTVPQVFINGKHIGGSDDTVEAYQSGKLAKLLGIEVGNK 128 Query: 181 EDL 189 +DL Sbjct: 129 DDL 131 >ref|XP_009796016.1| PREDICTED: glutaredoxin-C4 [Nicotiana sylvestris] Length = 135 Score = 102 bits (255), Expect = 4e-25 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDALSEIVGRRTVPQVFINGKH+GGSDDT+EAYE+GEL KLLGL + K Sbjct: 74 ELDERDDGWSIQDALSEIVGRRTVPQVFINGKHIGGSDDTVEAYENGELAKLLGL-SAKK 132 Query: 181 EDL 189 +DL Sbjct: 133 DDL 135 >gb|AFK38026.1| unknown [Medicago truncatula] Length = 131 Score = 102 bits (254), Expect = 5e-25 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L IVG+RTVPQVFINGKHLGGSD+T+EAYESG L KLLG++TV Sbjct: 69 ELDERDDGSKIQDVLVNIVGKRTVPQVFINGKHLGGSDETVEAYESGLLAKLLGIETVDH 128 Query: 181 EDL 189 +DL Sbjct: 129 DDL 131 >ref|XP_003595130.1| glutaredoxin C4 [Medicago truncatula] gi|355484178|gb|AES65381.1| glutaredoxin C4 [Medicago truncatula] Length = 131 Score = 102 bits (254), Expect = 5e-25 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L IVG+RTVPQVFINGKHLGGSD+T+EAYESG L KLLG++TV Sbjct: 69 ELDERDDGSKIQDVLVNIVGKRTVPQVFINGKHLGGSDETVEAYESGLLAKLLGIETVDH 128 Query: 181 EDL 189 +DL Sbjct: 129 DDL 131 >ref|XP_009619991.1| PREDICTED: glutaredoxin-C4 [Nicotiana tomentosiformis] Length = 145 Score = 102 bits (255), Expect = 5e-25 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG IQDALSEIVGRRTVPQVFINGKH+GGSDDT+EAYE+GEL KLLGL + K Sbjct: 84 ELDERDDGWSIQDALSEIVGRRTVPQVFINGKHIGGSDDTVEAYENGELAKLLGL-SAKK 142 Query: 181 EDL 189 +DL Sbjct: 143 DDL 145 >gb|AFK43763.1| unknown [Lotus japonicus] Length = 135 Score = 102 bits (254), Expect = 5e-25 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L IVG+RTVPQVFINGKHLGGSDDT+EAYESG L KLLG++T + Sbjct: 73 ELDERDDGSKIQDYLINIVGKRTVPQVFINGKHLGGSDDTVEAYESGLLAKLLGIETQAR 132 Query: 181 EDL 189 +DL Sbjct: 133 DDL 135 >ref|XP_010048610.1| PREDICTED: glutaredoxin-C4 [Eucalyptus grandis] gi|629116241|gb|KCW80916.1| hypothetical protein EUGRSUZ_C02279 [Eucalyptus grandis] gi|629116242|gb|KCW80917.1| hypothetical protein EUGRSUZ_C02279 [Eucalyptus grandis] gi|629116243|gb|KCW80918.1| hypothetical protein EUGRSUZ_C02279 [Eucalyptus grandis] Length = 135 Score = 101 bits (252), Expect = 1e-24 Identities = 48/63 (76%), Positives = 57/63 (90%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG KIQDALS+ +G+RTVPQVFINGKH+GGSDDT+EAYESGEL +LLG+D + Sbjct: 73 ELDERDDGWKIQDALSQRIGKRTVPQVFINGKHIGGSDDTVEAYESGELSQLLGIDGKEE 132 Query: 181 EDL 189 E+L Sbjct: 133 EEL 135 >ref|XP_015898903.1| PREDICTED: glutaredoxin-C4 [Ziziphus jujuba] Length = 140 Score = 101 bits (252), Expect = 1e-24 Identities = 47/62 (75%), Positives = 55/62 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+ IQDA++EI+GRRTVPQVFINGKH+GGSDDT+EAYESGEL KLLG+ + Sbjct: 77 ELDERDDGSDIQDAMAEIIGRRTVPQVFINGKHIGGSDDTVEAYESGELAKLLGIAAEDR 136 Query: 181 ED 186 D Sbjct: 137 ND 138 >ref|XP_003595129.1| glutaredoxin C4 [Medicago truncatula] gi|355484177|gb|AES65380.1| glutaredoxin C4 [Medicago truncatula] Length = 172 Score = 102 bits (254), Expect = 1e-24 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L IVG+RTVPQVFINGKHLGGSD+T+EAYESG L KLLG++TV Sbjct: 110 ELDERDDGSKIQDVLVNIVGKRTVPQVFINGKHLGGSDETVEAYESGLLAKLLGIETVDH 169 Query: 181 EDL 189 +DL Sbjct: 170 DDL 172 >gb|AFK48169.1| unknown [Lotus japonicus] Length = 135 Score = 101 bits (251), Expect = 1e-24 Identities = 49/63 (77%), Positives = 55/63 (87%) Frame = +1 Query: 1 ELDERDDGAKIQDALSEIVGRRTVPQVFINGKHLGGSDDTMEAYESGELEKLLGLDTVGK 180 ELDERDDG+KIQD L IVG+RTVPQVFINGKHLGGSDDT+EAYESG L KLLG++T Sbjct: 73 ELDERDDGSKIQDYLINIVGKRTVPQVFINGKHLGGSDDTVEAYESGLLAKLLGIETQAH 132 Query: 181 EDL 189 +DL Sbjct: 133 DDL 135