BLASTX nr result
ID: Rehmannia28_contig00022051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00022051 (318 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [... 103 8e-25 emb|CBI23472.3| unnamed protein product [Vitis vinifera] 93 3e-21 emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] 94 3e-21 ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog... 89 6e-21 ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunu... 93 7e-21 ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prun... 93 7e-21 ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog... 93 1e-20 emb|CDO99619.1| unnamed protein product [Coffea canephora] 92 2e-20 ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma... 91 3e-20 ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma... 91 5e-20 gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] 91 7e-20 ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [... 91 7e-20 ref|XP_015065838.1| PREDICTED: transmembrane protein 184C-like [... 90 1e-19 ref|XP_010316698.1| PREDICTED: transmembrane protein 184C [Solan... 90 1e-19 ref|XP_006347105.1| PREDICTED: transmembrane protein 184C [Solan... 90 1e-19 ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [... 89 2e-19 ref|XP_015887037.1| PREDICTED: transmembrane protein 184C-like [... 89 2e-19 ref|XP_002521429.1| PREDICTED: transmembrane protein 184 homolog... 89 4e-19 ref|XP_012443313.1| PREDICTED: transmembrane protein 184C-like [... 88 5e-19 ref|XP_006467880.1| PREDICTED: transmembrane protein 184C [Citru... 87 1e-18 >ref|XP_011096233.1| PREDICTED: transmembrane protein 184C-like [Sesamum indicum] Length = 295 Score = 103 bits (257), Expect = 8e-25 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLDTEHVEEAIQNVLVCVEMVIFSV+QQYAYHV+PYSGD+E+KLKMQKKYE Sbjct: 245 WLDTEHVEEAIQNVLVCVEMVIFSVIQQYAYHVAPYSGDIESKLKMQKKYE 295 >emb|CBI23472.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 92.8 bits (229), Expect = 3e-21 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH++EAIQNVLVCVEMV+FSVLQQYA+HV+PYSGD+EAKLK+ KK E Sbjct: 170 WLDVEHIQEAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 220 >emb|CAN61223.1| hypothetical protein VITISV_038806 [Vitis vinifera] Length = 295 Score = 94.4 bits (233), Expect = 3e-21 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH++EAIQNVLVCVEMV+FSVLQQYAYHV+PYSGD+EAKLK+ KK E Sbjct: 245 WLDVEHIQEAIQNVLVCVEMVVFSVLQQYAYHVAPYSGDMEAKLKLSKKRE 295 >ref|XP_011461975.1| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Fragaria vesca subsp. vesca] Length = 129 Score = 89.4 bits (220), Expect = 6e-21 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+ EAIQNVL+C+EMV+FSVLQQYAYHV+PYSGDVE K+++ KK E Sbjct: 79 WLDVEHINEAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVETKMRVNKKNE 129 >ref|XP_008224968.1| PREDICTED: transmembrane protein 184C [Prunus mume] Length = 295 Score = 93.2 bits (230), Expect = 7e-21 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+EEAIQNVL+C+EMV+FSVLQQYAYHV+PYSGDVE+K+K+ KK E Sbjct: 245 WLDVEHIEEAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >ref|XP_007211718.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] gi|462407583|gb|EMJ12917.1| hypothetical protein PRUPE_ppa009378mg [Prunus persica] Length = 295 Score = 93.2 bits (230), Expect = 7e-21 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+EEAIQNVL+C+EMV+FSVLQQYAYHV+PYSGDVE+K+K+ KK E Sbjct: 245 WLDVEHIEEAIQNVLICLEMVVFSVLQQYAYHVAPYSGDVESKMKLNKKRE 295 >ref|XP_002268954.2| PREDICTED: transmembrane protein 184 homolog DDB_G0279555-like [Vitis vinifera] Length = 295 Score = 92.8 bits (229), Expect = 1e-20 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH++EAIQNVLVCVEMV+FSVLQQYA+HV+PYSGD+EAKLK+ KK E Sbjct: 245 WLDVEHIQEAIQNVLVCVEMVVFSVLQQYAFHVAPYSGDMEAKLKLSKKRE 295 >emb|CDO99619.1| unnamed protein product [Coffea canephora] Length = 295 Score = 92.0 bits (227), Expect = 2e-20 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EHVEEAIQN+L+CVEMV FSV+QQYAYHV+PY+GDVEA LK +KKYE Sbjct: 245 WLDVEHVEEAIQNLLICVEMVAFSVIQQYAYHVAPYTGDVEALLKSRKKYE 295 >ref|XP_007025760.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508781126|gb|EOY28382.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 258 Score = 90.9 bits (224), Expect = 3e-20 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+EEA+QNVLVC+EMV+FSVLQQYAYHV+PYSG+VEAK+K+ KK E Sbjct: 208 WLDVEHLEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 258 >ref|XP_007025759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590624999|ref|XP_007025761.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781125|gb|EOY28381.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508781127|gb|EOY28383.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 295 Score = 90.9 bits (224), Expect = 5e-20 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+EEA+QNVLVC+EMV+FSVLQQYAYHV+PYSG+VEAK+K+ KK E Sbjct: 245 WLDVEHLEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGEVEAKMKLGKKNE 295 >gb|KDP20899.1| hypothetical protein JCGZ_21370 [Jatropha curcas] Length = 289 Score = 90.5 bits (223), Expect = 7e-20 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKK 171 WLD EH+EEA+QNVLVC+EMV+FSVLQQYAYHV+PYSGD EAK++++KK Sbjct: 240 WLDVEHIEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKK 288 >ref|XP_012091517.1| PREDICTED: transmembrane protein 184C-like [Jatropha curcas] Length = 294 Score = 90.5 bits (223), Expect = 7e-20 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKK 171 WLD EH+EEA+QNVLVC+EMV+FSVLQQYAYHV+PYSGD EAK++++KK Sbjct: 245 WLDVEHIEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGDAEAKMRLKKK 293 >ref|XP_015065838.1| PREDICTED: transmembrane protein 184C-like [Solanum pennellii] gi|970009879|ref|XP_015065839.1| PREDICTED: transmembrane protein 184C-like [Solanum pennellii] Length = 294 Score = 89.7 bits (221), Expect = 1e-19 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQK 174 WLD EH++EAIQNVL+CVEMV FSV+QQYAYHV+PYSGDVEAKLK++K Sbjct: 245 WLDVEHLQEAIQNVLICVEMVFFSVMQQYAYHVAPYSGDVEAKLKLKK 292 >ref|XP_010316698.1| PREDICTED: transmembrane protein 184C [Solanum lycopersicum] Length = 294 Score = 89.7 bits (221), Expect = 1e-19 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQK 174 WLD EH++EAIQNVL+CVEMV FSV+QQYAYHV+PYSGDVEAKLK++K Sbjct: 245 WLDVEHLQEAIQNVLICVEMVFFSVMQQYAYHVAPYSGDVEAKLKLKK 292 >ref|XP_006347105.1| PREDICTED: transmembrane protein 184C [Solanum tuberosum] gi|565360704|ref|XP_006347106.1| PREDICTED: transmembrane protein 184C [Solanum tuberosum] Length = 294 Score = 89.7 bits (221), Expect = 1e-19 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQK 174 WLD EH++EAIQNVL+CVEMV FSV+QQYAYHV+PYSGDVEAKLK++K Sbjct: 245 WLDVEHLQEAIQNVLICVEMVFFSVMQQYAYHVAPYSGDVEAKLKLKK 292 >ref|XP_010057489.1| PREDICTED: transmembrane protein 184C-like [Eucalyptus grandis] gi|629109547|gb|KCW74693.1| hypothetical protein EUGRSUZ_E03424 [Eucalyptus grandis] Length = 294 Score = 89.4 bits (220), Expect = 2e-19 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKK 171 WLD EH+EEAIQNVLVC+EMV+FSVLQQYAYHV+PYSG+ E+KLK++K+ Sbjct: 245 WLDVEHIEEAIQNVLVCLEMVVFSVLQQYAYHVAPYSGETESKLKLKKR 293 >ref|XP_015887037.1| PREDICTED: transmembrane protein 184C-like [Ziziphus jujuba] gi|1009108857|ref|XP_015887045.1| PREDICTED: transmembrane protein 184C-like [Ziziphus jujuba] Length = 295 Score = 89.4 bits (220), Expect = 2e-19 Identities = 38/49 (77%), Positives = 46/49 (93%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKK 171 WLD EH+++A QN+LVC+EMV+FSVLQQYAYHV+PYSGDVEAKLK+ KK Sbjct: 245 WLDVEHIQKATQNILVCMEMVVFSVLQQYAYHVAPYSGDVEAKLKLNKK 293 >ref|XP_002521429.1| PREDICTED: transmembrane protein 184 homolog DDB_G0279555 [Ricinus communis] gi|223539328|gb|EEF40919.1| conserved hypothetical protein [Ricinus communis] Length = 294 Score = 88.6 bits (218), Expect = 4e-19 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQK 174 WLD EH+EEA+QNVLVC+EMV+FSVLQQYAYHV+PYSGD+E K+K+ K Sbjct: 245 WLDVEHIEEALQNVLVCLEMVVFSVLQQYAYHVAPYSGDIERKMKLNK 292 >ref|XP_012443313.1| PREDICTED: transmembrane protein 184C-like [Gossypium raimondii] gi|763790504|gb|KJB57500.1| hypothetical protein B456_009G172600 [Gossypium raimondii] gi|763790505|gb|KJB57501.1| hypothetical protein B456_009G172600 [Gossypium raimondii] gi|763790506|gb|KJB57502.1| hypothetical protein B456_009G172600 [Gossypium raimondii] Length = 295 Score = 88.2 bits (217), Expect = 5e-19 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+EEA+QNVLVC+EMV+F+VLQQYAYHV PYSG+ EAKLK+ KK E Sbjct: 245 WLDVEHLEEALQNVLVCLEMVVFAVLQQYAYHVYPYSGETEAKLKLGKKLE 295 >ref|XP_006467880.1| PREDICTED: transmembrane protein 184C [Citrus sinensis] gi|641857006|gb|KDO75772.1| hypothetical protein CISIN_1g020642mg [Citrus sinensis] Length = 295 Score = 87.0 bits (214), Expect = 1e-18 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -2 Query: 317 WLDTEHVEEAIQNVLVCVEMVIFSVLQQYAYHVSPYSGDVEAKLKMQKKYE 165 WLD EH+ EAIQNVLVC+EMV+FS++QQYAY +PYSGDVEAKLK+ KK E Sbjct: 245 WLDVEHINEAIQNVLVCLEMVVFSIIQQYAYPATPYSGDVEAKLKLNKKTE 295