BLASTX nr result
ID: Rehmannia28_contig00021894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00021894 (312 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097449.1| PREDICTED: glutathione S-transferase DHAR3, ... 60 1e-08 >ref|XP_011097449.1| PREDICTED: glutathione S-transferase DHAR3, chloroplastic [Sesamum indicum] Length = 269 Score = 60.1 bits (144), Expect = 1e-08 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = +1 Query: 169 MSTAKITPSATALSATIKHLSLRP---RLLFATRISAPGIGRRRPRNLGVA 312 MSTAKITP A ALS TIKHL+LRP R F TRI+ PG G+R LG+A Sbjct: 1 MSTAKITPPAAALSTTIKHLALRPRPTRRYFTTRITVPGFGKRPKNGLGMA 51