BLASTX nr result
ID: Rehmannia28_contig00021801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00021801 (301 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838897.1| PREDICTED: probable mitochondrial adenine nu... 64 8e-10 >ref|XP_012838897.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Erythranthe guttata] gi|604331645|gb|EYU36503.1| hypothetical protein MIMGU_mgv1a007343mg [Erythranthe guttata] Length = 410 Score = 63.5 bits (153), Expect = 8e-10 Identities = 37/72 (51%), Positives = 40/72 (55%), Gaps = 9/72 (12%) Frame = -2 Query: 189 MSGFDNRVE---------NSILYSGGLFLDXXXXXXXXXXXXSDEVRSSSFPVYSRRKGS 37 MSGF+ RVE NS+ YSGGLFLD EVR S P YSRRK Sbjct: 1 MSGFEIRVEKSHPVLPSKNSVFYSGGLFLDAGSIPSSVINTVCGEVRCYSCPAYSRRKRG 60 Query: 36 GFLCLSLSIKGK 1 FLCLSLS+KGK Sbjct: 61 DFLCLSLSVKGK 72