BLASTX nr result
ID: Rehmannia28_contig00021546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00021546 (524 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101132.1| PREDICTED: probable calcium-binding protein ... 94 1e-21 ref|XP_012852243.1| PREDICTED: probable calcium-binding protein ... 94 1e-21 ref|XP_011076310.1| PREDICTED: probable calcium-binding protein ... 93 4e-21 gb|KVI10089.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 92 7e-21 ref|XP_015058136.1| PREDICTED: probable calcium-binding protein ... 92 9e-21 ref|XP_006340368.1| PREDICTED: probable calcium-binding protein ... 92 9e-21 gb|AAT40490.1| EF hand family protein [Solanum demissum] 92 9e-21 ref|XP_009782653.1| PREDICTED: probable calcium-binding protein ... 92 1e-20 ref|XP_009758373.1| PREDICTED: probable calcium-binding protein ... 92 1e-20 ref|XP_009587438.1| PREDICTED: probable calcium-binding protein ... 92 1e-20 ref|XP_009587435.1| PREDICTED: probable calcium-binding protein ... 92 1e-20 ref|XP_012858899.1| PREDICTED: probable calcium-binding protein ... 92 1e-20 gb|KVH85693.1| Calcium-binding EF-hand [Cynara cardunculus var. ... 91 2e-20 gb|EPS60464.1| hypothetical protein M569_14338 [Genlisea aurea] 91 2e-20 ref|XP_004251250.1| PREDICTED: probable calcium-binding protein ... 91 4e-20 emb|CDP05304.1| unnamed protein product [Coffea canephora] 90 5e-20 gb|KNA17725.1| hypothetical protein SOVF_077420 [Spinacia oleracea] 90 7e-20 gb|AAY17313.1| polcalcin [Artemisia vulgaris] 90 8e-20 gb|EPS60667.1| hypothetical protein M569_14135 [Genlisea aurea] 89 1e-19 ref|XP_012087102.1| PREDICTED: probable calcium-binding protein ... 89 1e-19 >ref|XP_011101132.1| PREDICTED: probable calcium-binding protein CML13 [Sesamum indicum] Length = 147 Score = 94.4 bits (233), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 121 >ref|XP_012852243.1| PREDICTED: probable calcium-binding protein CML13 [Erythranthe guttata] gi|604305936|gb|EYU24993.1| hypothetical protein MIMGU_mgv1a015755mg [Erythranthe guttata] Length = 147 Score = 94.4 bits (233), Expect = 1e-21 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 121 >ref|XP_011076310.1| PREDICTED: probable calcium-binding protein CML13 [Sesamum indicum] Length = 145 Score = 92.8 bits (229), Expect = 4e-21 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDLRHILTSIGEKLEPAEFD Sbjct: 75 PEPFDRQLRDAFKVLDKDGTGFVVVSDLRHILTSIGEKLEPAEFD 119 >gb|KVI10089.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 147 Score = 92.4 bits (228), Expect = 7e-21 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKV+DKDGTGYVVVSDL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVIDKDGTGYVVVSDLKHILTSIGEKLEPAEFD 121 >ref|XP_015058136.1| PREDICTED: probable calcium-binding protein CML13 [Solanum pennellii] Length = 147 Score = 92.0 bits (227), Expect = 9e-21 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDL+HILTSIGEKLEP+EFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLKHILTSIGEKLEPSEFD 121 >ref|XP_006340368.1| PREDICTED: probable calcium-binding protein CML13 [Solanum tuberosum] Length = 147 Score = 92.0 bits (227), Expect = 9e-21 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDL+HILTSIGEKLEP+EFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLKHILTSIGEKLEPSEFD 121 >gb|AAT40490.1| EF hand family protein [Solanum demissum] Length = 147 Score = 92.0 bits (227), Expect = 9e-21 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDL+HILTSIGEKLEP+EFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLKHILTSIGEKLEPSEFD 121 >ref|XP_009782653.1| PREDICTED: probable calcium-binding protein CML13 [Nicotiana sylvestris] Length = 147 Score = 91.7 bits (226), Expect = 1e-20 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVVVSDLKHILTSIGEKLEPAEFD 121 >ref|XP_009758373.1| PREDICTED: probable calcium-binding protein CML13 [Nicotiana sylvestris] Length = 147 Score = 91.7 bits (226), Expect = 1e-20 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVVVSDLKHILTSIGEKLEPAEFD 121 >ref|XP_009587438.1| PREDICTED: probable calcium-binding protein CML13 [Nicotiana tomentosiformis] Length = 147 Score = 91.7 bits (226), Expect = 1e-20 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVVVSDLKHILTSIGEKLEPAEFD 121 >ref|XP_009587435.1| PREDICTED: probable calcium-binding protein CML13 [Nicotiana tomentosiformis] gi|697157363|ref|XP_009587436.1| PREDICTED: probable calcium-binding protein CML13 [Nicotiana tomentosiformis] Length = 147 Score = 91.7 bits (226), Expect = 1e-20 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVVVSDLKHILTSIGEKLEPAEFD 121 >ref|XP_012858899.1| PREDICTED: probable calcium-binding protein CML13 isoform X3 [Erythranthe guttata] gi|604299645|gb|EYU19488.1| hypothetical protein MIMGU_mgv1a015721mg [Erythranthe guttata] Length = 148 Score = 91.7 bits (226), Expect = 1e-20 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVS+LRHILTSIGEKL+PAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSELRHILTSIGEKLDPAEFD 121 >gb|KVH85693.1| Calcium-binding EF-hand [Cynara cardunculus var. scolymus] Length = 147 Score = 91.3 bits (225), Expect = 2e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKV+DKDGTGYVVV+DL+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVIDKDGTGYVVVADLKHILTSIGEKLEPAEFD 121 >gb|EPS60464.1| hypothetical protein M569_14338 [Genlisea aurea] Length = 147 Score = 91.3 bits (225), Expect = 2e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYV+VS+L+HILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVIVSELKHILTSIGEKLEPAEFD 121 >ref|XP_004251250.1| PREDICTED: probable calcium-binding protein CML13 [Solanum lycopersicum] Length = 147 Score = 90.5 bits (223), Expect = 4e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+VVVSDL+HILTSIGEKLEP+EFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVVVSDLKHILTSIGEKLEPSEFD 121 >emb|CDP05304.1| unnamed protein product [Coffea canephora] Length = 147 Score = 90.1 bits (222), Expect = 5e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 5 EPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 EPFDRQLRDAFKVLDKDGTG+VVVSDLRHILTSIGEKLEPAEFD Sbjct: 78 EPFDRQLRDAFKVLDKDGTGFVVVSDLRHILTSIGEKLEPAEFD 121 >gb|KNA17725.1| hypothetical protein SOVF_077420 [Spinacia oleracea] Length = 147 Score = 89.7 bits (221), Expect = 7e-20 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDK+GTG+V VSDLRHILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKEGTGFVAVSDLRHILTSIGEKLEPAEFD 121 >gb|AAY17313.1| polcalcin [Artemisia vulgaris] Length = 149 Score = 89.7 bits (221), Expect = 8e-20 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKV+DKDGTG+VVV+DL+HILTSIGEKLEPAEFD Sbjct: 79 PEPFDRQLRDAFKVIDKDGTGFVVVADLKHILTSIGEKLEPAEFD 123 >gb|EPS60667.1| hypothetical protein M569_14135 [Genlisea aurea] Length = 147 Score = 89.4 bits (220), Expect = 1e-19 Identities = 43/45 (95%), Positives = 43/45 (95%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLE EFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEAEEFD 121 >ref|XP_012087102.1| PREDICTED: probable calcium-binding protein CML13 [Jatropha curcas] gi|643712171|gb|KDP25599.1| hypothetical protein JCGZ_20755 [Jatropha curcas] Length = 147 Score = 89.0 bits (219), Expect = 1e-19 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +2 Query: 2 PEPFDRQLRDAFKVLDKDGTGYVVVSDLRHILTSIGEKLEPAEFD 136 PEPFDRQLRDAFKVLDKDGTG+V V DLRHILTSIGEKLEPAEFD Sbjct: 77 PEPFDRQLRDAFKVLDKDGTGFVSVGDLRHILTSIGEKLEPAEFD 121