BLASTX nr result
ID: Rehmannia28_contig00019276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019276 (361 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837478.1| PREDICTED: uncharacterized protein DDB_G0271... 79 2e-15 >ref|XP_012837478.1| PREDICTED: uncharacterized protein DDB_G0271670 [Erythranthe guttata] gi|604348630|gb|EYU46785.1| hypothetical protein MIMGU_mgv1a012405mg [Erythranthe guttata] Length = 251 Score = 78.6 bits (192), Expect = 2e-15 Identities = 49/84 (58%), Positives = 55/84 (65%), Gaps = 4/84 (4%) Frame = +3 Query: 120 MTEFMPRNDVIDIENVKESAYAT----AAAVNPPGKKKKSGAFGIFRAALLVLRKRRGGE 287 MTE MP ND ++ + K SA A VN KKKKSGAFGIFRAALL+LRKR G + Sbjct: 1 MTESMPEND-FNVASDKTSAVAADDGKPPLVNAERKKKKSGAFGIFRAALLMLRKRPGEK 59 Query: 288 KGAKNVLAKQNSTASNNSNWTKLV 359 K AK +KQ STASN S W KLV Sbjct: 60 KAAKKTASKQKSTASNGS-WAKLV 82