BLASTX nr result
ID: Rehmannia28_contig00019028
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00019028 (401 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847953.1| PREDICTED: cysteine proteinase inhibitor B-l... 60 3e-09 ref|XP_012853126.1| PREDICTED: cysteine proteinase inhibitor B-l... 60 3e-09 ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [... 55 4e-07 ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-l... 54 1e-06 ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-l... 54 2e-06 ref|XP_015087922.1| PREDICTED: cysteine proteinase inhibitor B [... 53 2e-06 ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B [... 53 2e-06 ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [... 52 4e-06 ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [... 52 7e-06 >ref|XP_012847953.1| PREDICTED: cysteine proteinase inhibitor B-like [Erythranthe guttata] gi|604316037|gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata] Length = 132 Score = 60.5 bits (145), Expect = 3e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 307 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GGK GGR +VKNV+ANK+VQDLGRYCVQEYN Sbjct: 25 GGKVGGRTEVKNVKANKDVQDLGRYCVQEYN 55 >ref|XP_012853126.1| PREDICTED: cysteine proteinase inhibitor B-like [Erythranthe guttata] gi|604305097|gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata] Length = 135 Score = 60.5 bits (145), Expect = 3e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 307 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GGK GGR +VKNV+ANK+VQDLGRYCVQEYN Sbjct: 29 GGKVGGRTEVKNVKANKDVQDLGRYCVQEYN 59 >ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum] Length = 134 Score = 55.1 bits (131), Expect = 4e-07 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +1 Query: 307 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GGK GGR Q+KNV+ N+E+QDLG+YCV+E+N Sbjct: 28 GGKLGGRTQIKNVKTNQEIQDLGKYCVEEHN 58 >ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis] gi|662706313|gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum] Length = 136 Score = 53.5 bits (127), Expect = 1e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +1 Query: 301 IGGGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 +GG K GGR Q+++V+ NKE+QDLG++CV+EYN Sbjct: 28 LGGKKLGGRTQIQDVKTNKEIQDLGKFCVEEYN 60 >ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris] Length = 138 Score = 53.5 bits (127), Expect = 2e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = +1 Query: 301 IGGGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 +GG K GGR Q+++V+ NKE+QDLG++CV+EYN Sbjct: 28 LGGKKLGGRTQIQDVKTNKEIQDLGKFCVEEYN 60 >ref|XP_015087922.1| PREDICTED: cysteine proteinase inhibitor B [Solanum pennellii] Length = 135 Score = 53.1 bits (126), Expect = 2e-06 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = +1 Query: 307 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GGK GGR Q+K+V+ N+E+QDLG+YCV+E+N Sbjct: 28 GGKLGGRTQIKDVKTNQEIQDLGKYCVEEHN 58 >ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B [Solanum tuberosum] Length = 135 Score = 53.1 bits (126), Expect = 2e-06 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = +1 Query: 307 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GGK GGR Q+K+V+ N+E+QDLG+YCV+E+N Sbjct: 28 GGKLGGRTQIKDVKTNQEIQDLGKYCVEEHN 58 >ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum] Length = 131 Score = 52.4 bits (124), Expect = 4e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 310 GKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GK GGR QVKNV+ N+E+Q+LGRYCV EYN Sbjct: 26 GKVGGRTQVKNVKQNQEIQELGRYCVGEYN 55 >ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [Phoenix dactylifera] Length = 125 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 304 GGGKFGGRAQVKNVEANKEVQDLGRYCVQEYN 399 GG K GGR +V +VE+NKEVQDLG +CV+EYN Sbjct: 28 GGRKVGGRTEVPHVESNKEVQDLGLFCVEEYN 59