BLASTX nr result
ID: Rehmannia28_contig00016960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016960 (439 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 5e-27 ref|XP_012835226.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 109 3e-25 ref|XP_012085200.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 105 8e-24 ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 105 8e-24 ref|XP_002534361.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 102 7e-23 ref|XP_002535081.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 102 7e-23 ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 102 1e-22 dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] 102 1e-22 ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 102 1e-22 emb|CDP03935.1| unnamed protein product [Coffea canephora] 102 1e-22 ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_015088510.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_015079420.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-22 ref|XP_006363450.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 100 4e-22 gb|KCW48408.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus g... 100 4e-22 ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 100 5e-22 emb|CBI41091.3| unnamed protein product [Vitis vinifera] 99 5e-22 >ref|XP_011089642.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Sesamum indicum] Length = 573 Score = 114 bits (285), Expect = 5e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALE+DPDNR+VKL YKALKEKVKE+NKKDAKFYGNMFAKLNKLQPFDSNNT Sbjct: 502 AEFDIKKALELDPDNREVKLVYKALKEKVKEYNKKDAKFYGNMFAKLNKLQPFDSNNT 559 >ref|XP_012835226.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Erythranthe guttata] gi|604335244|gb|EYU39186.1| hypothetical protein MIMGU_mgv1a003614mg [Erythranthe guttata] Length = 574 Score = 109 bits (272), Expect = 3e-25 Identities = 53/57 (92%), Positives = 53/57 (92%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNN 173 AEFDIKKALEIDPDNRDVKLEYK LKEKVKE NKKDAKFYGNMFAKL KLQ FDSNN Sbjct: 503 AEFDIKKALEIDPDNRDVKLEYKVLKEKVKEINKKDAKFYGNMFAKLTKLQTFDSNN 559 >ref|XP_012085200.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Jatropha curcas] gi|643739521|gb|KDP45275.1| hypothetical protein JCGZ_15140 [Jatropha curcas] Length = 572 Score = 105 bits (262), Expect = 8e-24 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEIDPDNRDVKLEYK LKEK++E+NKK+AKFYGNMFAK+NKL P DSN + S Sbjct: 502 AEFDIKKALEIDPDNRDVKLEYKTLKEKMREYNKKEAKFYGNMFAKMNKLGPLDSNKSES 561 >ref|XP_009803135.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana sylvestris] Length = 573 Score = 105 bits (262), Expect = 8e-24 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEIDPDNRDVKLEYKALK+KVKEFNKKDAKFYGNMFAKLNKL+ +S+ + S Sbjct: 502 AEFDIKKALEIDPDNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKSAS 561 >ref|XP_002534361.2| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62, partial [Ricinus communis] Length = 568 Score = 102 bits (255), Expect = 7e-23 Identities = 47/60 (78%), Positives = 55/60 (91%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEI+PDNRDVKLEY+ LK+K++E NKK+AKFYGNMFAK+NKL P DSNN+ S Sbjct: 503 AEFDIKKALEIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNNSKS 562 >ref|XP_002535081.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62 [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] Length = 574 Score = 102 bits (255), Expect = 7e-23 Identities = 47/60 (78%), Positives = 55/60 (91%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEI+PDNRDVKLEY+ LK+K++E NKK+AKFYGNMFAK+NKL P DSNN+ S Sbjct: 503 AEFDIKKALEIEPDNRDVKLEYRTLKDKMRELNKKEAKFYGNMFAKMNKLGPLDSNNSKS 562 >ref|XP_009602562.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana tomentosiformis] Length = 573 Score = 102 bits (254), Expect = 1e-22 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDP+NRDVKLEYKALK+KVKEFNKKDAKFYGNMFAKLNKL+ +S+ + Sbjct: 502 AEFDIKKALEIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKS 559 >dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] Length = 573 Score = 102 bits (254), Expect = 1e-22 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDP+NRDVKLEYKALK+KVKEFNKKDAKFYGNMFAKLNKL+ +S+ + Sbjct: 502 AEFDIKKALEIDPNNRDVKLEYKALKDKVKEFNKKDAKFYGNMFAKLNKLETANSSKS 559 >ref|XP_009610546.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana tomentosiformis] Length = 565 Score = 102 bits (253), Expect = 1e-22 Identities = 52/60 (86%), Positives = 55/60 (91%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEIDP NRDVKLEYKALKEKVKE+NKKDAKFYGNMFAKLNKL +SNN+ S Sbjct: 495 AEFDIKKALEIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNMFAKLNKLD-VNSNNSAS 553 >emb|CDP03935.1| unnamed protein product [Coffea canephora] Length = 575 Score = 102 bits (253), Expect = 1e-22 Identities = 49/58 (84%), Positives = 52/58 (89%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AE DIKKALEIDP+NRDVKLEYK LKEKVKE+NKKDAKFYGNMFAKLNKL+ D N T Sbjct: 504 AELDIKKALEIDPNNRDVKLEYKVLKEKVKEYNKKDAKFYGNMFAKLNKLESVDLNKT 561 >ref|XP_010036767.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform X1 [Eucalyptus grandis] gi|629081962|gb|KCW48407.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis] Length = 576 Score = 101 bits (252), Expect = 2e-22 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDP NRDVKLEYK LKEKVKEFNKKDAKFYGNMFAK++KL+P + T Sbjct: 505 AEFDIKKALEIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPVEMQKT 562 >ref|XP_015088510.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum pennellii] Length = 555 Score = 101 bits (251), Expect = 2e-22 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL 152 AEFDIKKALEIDP+NRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL Sbjct: 503 AEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL 552 >ref|XP_004247044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum lycopersicum] Length = 557 Score = 101 bits (251), Expect = 2e-22 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL 152 AEFDIKKALEIDP+NRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL Sbjct: 503 AEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL 552 >ref|XP_015079420.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum pennellii] Length = 574 Score = 101 bits (251), Expect = 2e-22 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDPDNRDVKLEYKALKEKVKE NKKDAKFYGNMFAKLNK +S N+ Sbjct: 503 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDSANSANS 560 >ref|XP_006352668.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum tuberosum] Length = 574 Score = 101 bits (251), Expect = 2e-22 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDPDNRDVKLEYKALKEKVKE NKKDAKFYGNMFAKLNK +S N+ Sbjct: 503 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDAANSANS 560 >ref|XP_004242423.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Solanum lycopersicum] Length = 574 Score = 101 bits (251), Expect = 2e-22 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNT 176 AEFDIKKALEIDPDNRDVKLEYKALKEKVKE NKKDAKFYGNMFAKLNK +S N+ Sbjct: 503 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAKFYGNMFAKLNKQDSSNSANS 560 >ref|XP_006363450.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform X1 [Solanum tuberosum] gi|971579317|ref|XP_015158937.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform X1 [Solanum tuberosum] Length = 453 Score = 100 bits (248), Expect = 4e-22 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKL 152 AEFDIKKALEIDP+NRDVKLEYKALKEKVKEFNKKDAKFYGNMFA+LNKL Sbjct: 401 AEFDIKKALEIDPNNRDVKLEYKALKEKVKEFNKKDAKFYGNMFARLNKL 450 >gb|KCW48408.1| hypothetical protein EUGRSUZ_K02110 [Eucalyptus grandis] Length = 468 Score = 100 bits (248), Expect = 4e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFD 164 AEFDIKKALEIDP NRDVKLEYK LKEKVKEFNKKDAKFYGNMFAK++KL+P + Sbjct: 399 AEFDIKKALEIDPHNRDVKLEYKVLKEKVKEFNKKDAKFYGNMFAKMSKLEPVE 452 >ref|XP_009787495.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Nicotiana sylvestris] Length = 570 Score = 100 bits (249), Expect = 5e-22 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSNNTXS 182 AEFDIKKALEIDP NRDVKLEYKALKEKVKE+NKKDAKFYGN+FAKLNKL +SNN+ S Sbjct: 500 AEFDIKKALEIDPANRDVKLEYKALKEKVKEYNKKDAKFYGNIFAKLNKLD-VNSNNSAS 558 >emb|CBI41091.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 98.6 bits (244), Expect = 5e-22 Identities = 44/56 (78%), Positives = 53/56 (94%) Frame = +3 Query: 3 AEFDIKKALEIDPDNRDVKLEYKALKEKVKEFNKKDAKFYGNMFAKLNKLQPFDSN 170 AEFDIKKALEIDPDNRDVKLEY+ LKEK+KE+NKK+AKFYGNMFA++NKL+ ++N Sbjct: 272 AEFDIKKALEIDPDNRDVKLEYRTLKEKMKEYNKKEAKFYGNMFARMNKLEALETN 327