BLASTX nr result
ID: Rehmannia28_contig00016210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016210 (437 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHF98112.1| Dihydroflavonol-4-reductase -like protein [Gossyp... 55 4e-06 ref|XP_012843597.1| PREDICTED: vestitone reductase-like [Erythra... 54 4e-06 ref|XP_007052061.1| NAD(P)-binding Rossmann-fold superfamily pro... 54 9e-06 >gb|KHF98112.1| Dihydroflavonol-4-reductase -like protein [Gossypium arboreum] Length = 328 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 1 PGLSSKKLMETGFKFENGLGEMYDGAIKSCKGIG 102 PGLSSKKL+ETGF+F+NG+ EM+DGAI+ CK G Sbjct: 293 PGLSSKKLLETGFEFKNGVEEMFDGAIQCCKERG 326 >ref|XP_012843597.1| PREDICTED: vestitone reductase-like [Erythranthe guttata] gi|604321411|gb|EYU31987.1| hypothetical protein MIMGU_mgv1a012358mg [Erythranthe guttata] Length = 253 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 4 GLSSKKLMETGFKFENGLGEMYDGAIKSCKGIG 102 GLS+KKL ETGFK+ENGL EM+DGAI+SCK G Sbjct: 217 GLSTKKLEETGFKYENGLEEMFDGAIQSCKEKG 249 >ref|XP_007052061.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2, partial [Theobroma cacao] gi|508704322|gb|EOX96218.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2, partial [Theobroma cacao] Length = 287 Score = 53.5 bits (127), Expect = 9e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 PGLSSKKLMETGFKFENGLGEMYDGAIKSCKGIG 102 PGLSSKKLM+TGFKF+ G+ EM DGAIK CK G Sbjct: 252 PGLSSKKLMDTGFKFQYGVEEMLDGAIKCCKEKG 285