BLASTX nr result
ID: Rehmannia28_contig00015258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00015258 (393 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containi... 91 7e-19 ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-18 >ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848706|ref|XP_012853630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848710|ref|XP_012853693.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848713|ref|XP_012853760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848716|ref|XP_012853815.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848720|ref|XP_012853859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] gi|848848724|ref|XP_012853912.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] Length = 745 Score = 90.9 bits (224), Expect = 7e-19 Identities = 47/86 (54%), Positives = 61/86 (70%), Gaps = 2/86 (2%) Frame = +2 Query: 140 MASTMIRKNLILNPHFHFPSQNLIYINRFTTRPHLNPDSISADQD--LVETQITSLCRKP 313 MA T+ R N LNP FHF S ++ + T PH N S SA+Q+ +VET+I SLC+KP Sbjct: 3 MALTISRNNRFLNPSFHFRSGVILLTHFLTPAPHFNHFSTSANQESNIVETRIESLCQKP 62 Query: 314 NSLIDLRKAFSLFEKSVDGGLVPSGP 391 NS+++LRKA S FE++VD GLVPSGP Sbjct: 63 NSIVNLRKAVSFFEETVDTGLVPSGP 88 >ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067389|ref|XP_011080414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067391|ref|XP_011080415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] Length = 742 Score = 89.7 bits (221), Expect = 2e-18 Identities = 47/85 (55%), Positives = 62/85 (72%), Gaps = 1/85 (1%) Frame = +2 Query: 140 MASTMIRKNLILNPHFHFPSQNLIYINRFTTRPHLNPDSISADQ-DLVETQITSLCRKPN 316 MA T+IRKN +L+P+ FPSQN IN ++ P+LN SA D VETQI+SLC+K N Sbjct: 1 MALTIIRKNFLLHPYLLFPSQNRNLINLLSSTPNLNTVCDSAAYLDTVETQISSLCQKSN 60 Query: 317 SLIDLRKAFSLFEKSVDGGLVPSGP 391 S + R+AFS+F++SVD GL+PSGP Sbjct: 61 SSVQFREAFSIFQQSVDMGLIPSGP 85