BLASTX nr result
ID: Rehmannia28_contig00014489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014489 (434 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080725.1| PREDICTED: LRR repeats and ubiquitin-like do... 114 4e-28 ref|XP_011080722.1| PREDICTED: LRR repeats and ubiquitin-like do... 114 1e-27 ref|XP_011080721.1| PREDICTED: LRR repeats and ubiquitin-like do... 114 2e-27 ref|XP_012838110.1| PREDICTED: LRR repeats and ubiquitin-like do... 109 6e-26 emb|CDP10058.1| unnamed protein product [Coffea canephora] 99 2e-24 emb|CDP09232.1| unnamed protein product [Coffea canephora] 105 2e-24 ref|XP_015579324.1| PREDICTED: plant intracellular Ras-group-rel... 101 3e-23 ref|XP_015579323.1| PREDICTED: LRR repeats and ubiquitin-like do... 101 5e-23 emb|CAN65127.1| hypothetical protein VITISV_005830 [Vitis vinifera] 99 8e-22 ref|XP_002275653.1| PREDICTED: LRR repeats and ubiquitin-like do... 99 8e-22 gb|KJB20435.1| hypothetical protein B456_003G148100 [Gossypium r... 97 9e-22 gb|EPS66682.1| hypothetical protein M569_08094, partial [Genlise... 98 1e-21 ref|XP_006425121.1| hypothetical protein CICLE_v100287042mg, par... 91 2e-21 ref|XP_012078954.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 2e-21 ref|XP_012471662.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 2e-21 gb|KHG29821.1| hypothetical protein F383_15066 [Gossypium arboreum] 97 2e-21 gb|KDP45775.1| hypothetical protein JCGZ_17382 [Jatropha curcas] 97 2e-21 ref|XP_015874575.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 4e-21 ref|XP_009802173.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 4e-21 ref|XP_009590109.1| PREDICTED: LRR repeats and ubiquitin-like do... 97 4e-21 >ref|XP_011080725.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X3 [Sesamum indicum] Length = 307 Score = 114 bits (284), Expect = 4e-28 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LSILDLHGTEIT+DLLRQFEGWESFDERRRLKHQKQLDFRVTGS+EFDEGAD+NW Sbjct: 244 LSILDLHGTEITLDLLRQFEGWESFDERRRLKHQKQLDFRVTGSSEFDEGADRNW 298 >ref|XP_011080722.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X2 [Sesamum indicum] Length = 375 Score = 114 bits (284), Expect = 1e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LSILDLHGTEIT+DLLRQFEGWESFDERRRLKHQKQLDFRVTGS+EFDEGAD+NW Sbjct: 321 LSILDLHGTEITLDLLRQFEGWESFDERRRLKHQKQLDFRVTGSSEFDEGADRNW 375 >ref|XP_011080721.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X1 [Sesamum indicum] Length = 384 Score = 114 bits (284), Expect = 2e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LSILDLHGTEIT+DLLRQFEGWESFDERRRLKHQKQLDFRVTGS+EFDEGAD+NW Sbjct: 321 LSILDLHGTEITLDLLRQFEGWESFDERRRLKHQKQLDFRVTGSSEFDEGADRNW 375 >ref|XP_012838110.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Erythranthe guttata] Length = 367 Score = 109 bits (272), Expect = 6e-26 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LS LDLH TEIT DLLRQFEGWESFDERRRLKHQKQLDFRV+GSAEFDEGADKNW Sbjct: 313 LSTLDLHNTEITTDLLRQFEGWESFDERRRLKHQKQLDFRVSGSAEFDEGADKNW 367 >emb|CDP10058.1| unnamed protein product [Coffea canephora] Length = 110 Score = 99.4 bits (246), Expect = 2e-24 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LSILDLHGTE+TMD+LRQFEGW+ FD RRRLKHQKQLDFRV+ SAEFDEGAD ++ Sbjct: 52 LSILDLHGTEVTMDVLRQFEGWDDFDNRRRLKHQKQLDFRVSRSAEFDEGADNSY 106 >emb|CDP09232.1| unnamed protein product [Coffea canephora] Length = 379 Score = 105 bits (262), Expect = 2e-24 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKNW 165 LSILDLHGTE+TMD+LRQFEGW+ FD RRRLKHQKQLDFRVTGSAEFDEGADK + Sbjct: 325 LSILDLHGTEVTMDVLRQFEGWDDFDNRRRLKHQKQLDFRVTGSAEFDEGADKRY 379 >ref|XP_015579324.1| PREDICTED: plant intracellular Ras-group-related LRR protein 8 isoform X2 [Ricinus communis] Length = 318 Score = 101 bits (252), Expect = 3e-23 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LDLH TEIT D+LRQFEGWE+FD+RRRLKHQKQLDFRV GSAEFDEGADKN Sbjct: 265 LSTLDLHNTEITTDMLRQFEGWEAFDDRRRLKHQKQLDFRVVGSAEFDEGADKN 318 >ref|XP_015579323.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X1 [Ricinus communis] Length = 372 Score = 101 bits (252), Expect = 5e-23 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LDLH TEIT D+LRQFEGWE+FD+RRRLKHQKQLDFRV GSAEFDEGADKN Sbjct: 319 LSTLDLHNTEITTDMLRQFEGWEAFDDRRRLKHQKQLDFRVVGSAEFDEGADKN 372 >emb|CAN65127.1| hypothetical protein VITISV_005830 [Vitis vinifera] Length = 380 Score = 98.6 bits (244), Expect = 8e-22 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LDLHGTEITMDLLRQFEGWE+FDERRR KHQKQLDFRV S FDEGADKN Sbjct: 327 LSTLDLHGTEITMDLLRQFEGWENFDERRRDKHQKQLDFRVVDSTAFDEGADKN 380 >ref|XP_002275653.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Vitis vinifera] gi|297745853|emb|CBI15909.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 98.6 bits (244), Expect = 8e-22 Identities = 47/54 (87%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LDLHGTEITMDLLRQFEGWE+FDERRR KHQKQLDFRV S FDEGADKN Sbjct: 327 LSTLDLHGTEITMDLLRQFEGWENFDERRRDKHQKQLDFRVVDSTAFDEGADKN 380 >gb|KJB20435.1| hypothetical protein B456_003G148100 [Gossypium raimondii] Length = 310 Score = 97.4 bits (241), Expect = 9e-22 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 L+ LDLH TEITMD+LRQFEGWE FDERRR KHQKQLDFRV SA+FDEGADKN Sbjct: 257 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADKN 310 >gb|EPS66682.1| hypothetical protein M569_08094, partial [Genlisea aurea] Length = 366 Score = 97.8 bits (242), Expect = 1e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LSILDLH T+IT DLLRQ GWE FDERRRLKHQKQLDFR+TGS +FDEGADKN Sbjct: 313 LSILDLHNTQITADLLRQLAGWERFDERRRLKHQKQLDFRITGSGDFDEGADKN 366 >ref|XP_006425121.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] gi|567864946|ref|XP_006425122.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] gi|567864948|ref|XP_006425123.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] gi|557527055|gb|ESR38361.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] gi|557527056|gb|ESR38362.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] gi|557527057|gb|ESR38363.1| hypothetical protein CICLE_v100287042mg, partial [Citrus clementina] Length = 98 Score = 91.3 bits (225), Expect = 2e-21 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS L+LH TEITMD LRQ EGW+ FD+RRR KHQKQLDFRV GS EFDEGADK+ Sbjct: 45 LSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS 98 >ref|XP_012078954.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Jatropha curcas] Length = 372 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LD+H TEITMD+LRQF+GW FDERRRLKHQKQLDFRV GSAEFDE ADKN Sbjct: 319 LSTLDIHNTEITMDILRQFDGWNDFDERRRLKHQKQLDFRVVGSAEFDECADKN 372 >ref|XP_012471662.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 isoform X2 [Gossypium raimondii] gi|763753044|gb|KJB20432.1| hypothetical protein B456_003G148100 [Gossypium raimondii] Length = 373 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 L+ LDLH TEITMD+LRQFEGWE FDERRR KHQKQLDFRV SA+FDEGADKN Sbjct: 320 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADKN 373 >gb|KHG29821.1| hypothetical protein F383_15066 [Gossypium arboreum] Length = 373 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 L+ LDLH TEITMD+LRQFEGWE FDERRR KHQKQLDFRV SA+FDEGADKN Sbjct: 320 LATLDLHNTEITMDVLRQFEGWEEFDERRRSKHQKQLDFRVVSSAQFDEGADKN 373 >gb|KDP45775.1| hypothetical protein JCGZ_17382 [Jatropha curcas] Length = 389 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LS LD+H TEITMD+LRQF+GW FDERRRLKHQKQLDFRV GSAEFDE ADKN Sbjct: 336 LSTLDIHNTEITMDILRQFDGWNDFDERRRLKHQKQLDFRVVGSAEFDECADKN 389 >ref|XP_015874575.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Ziziphus jujuba] Length = 374 Score = 96.7 bits (239), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 L+ LDLH TEIT+DLLRQFEGWE+F+ERRRLK+QKQLDFRV GSA FDEGADKN Sbjct: 321 LTTLDLHNTEITVDLLRQFEGWENFEERRRLKNQKQLDFRVVGSAAFDEGADKN 374 >ref|XP_009802173.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana sylvestris] Length = 377 Score = 96.7 bits (239), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LSILDLHGTEITMD+LRQ EGWE+FDERRR KHQKQL+FRV SA+FDEGADK+ Sbjct: 324 LSILDLHGTEITMDVLRQLEGWENFDERRRSKHQKQLEFRVISSAKFDEGADKS 377 >ref|XP_009590109.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana tomentosiformis] gi|697162621|ref|XP_009590110.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana tomentosiformis] gi|697162623|ref|XP_009590111.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana tomentosiformis] Length = 382 Score = 96.7 bits (239), Expect = 4e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 1 LSILDLHGTEITMDLLRQFEGWESFDERRRLKHQKQLDFRVTGSAEFDEGADKN 162 LSILDLHGTEITMD+LRQ EGWE+FDERRR KHQKQL+FRV SA+FDEGADK+ Sbjct: 329 LSILDLHGTEITMDVLRQLEGWENFDERRRSKHQKQLEFRVISSAKFDEGADKS 382