BLASTX nr result
ID: Rehmannia28_contig00014450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014450 (339 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlise... 74 1e-15 >gb|EPS71012.1| hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 74.3 bits (181), Expect = 1e-15 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 2/42 (4%) Frame = -1 Query: 339 FSREVV--GMAWIMLRIDYSRLFWLLFGVFSYENHEGKPRIF 220 FSR+ V G+ WIMLRIDYSRL WLLFGVFSYENHEGKPRIF Sbjct: 20 FSRQAVAVGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRIF 61