BLASTX nr result
ID: Rehmannia28_contig00014425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014425 (433 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013443726.1| hypothetical protein MTR_0001s0120 [Medicago... 54 2e-06 >ref|XP_013443726.1| hypothetical protein MTR_0001s0120 [Medicago truncatula] gi|657371771|gb|KEH17751.1| hypothetical protein MTR_0001s0120 [Medicago truncatula] Length = 141 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = +1 Query: 298 HGILFQDDEQATRYQQLLSKPLHNTRYPDAMTLETLGIQEDI 423 HGI+F+D++Q RY+ L+SKPLH RYPD L TLG+++++ Sbjct: 28 HGIIFKDNKQRDRYKNLISKPLHPCRYPDNYDLITLGLRDNV 69