BLASTX nr result
ID: Rehmannia28_contig00013302
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013302 (380 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ73902.1| MnSOD2, partial [Solanum nigrum] 68 4e-13 emb|CAC19487.1| manganese superoxide dismutase 2 [Prunus persica] 69 5e-13 gb|AIZ49390.1| Mn superoxide dismutase 1, partial [Rosa hybrid c... 67 9e-13 ref|XP_011084834.1| PREDICTED: superoxide dismutase [Mn], mitoch... 68 1e-12 gb|KYP69459.1| hypothetical protein KK1_008649, partial [Cajanus... 69 2e-12 gb|AKN79289.1| superoxide dismutase 4 [Betula platyphylla] 70 3e-12 emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] 70 4e-12 gb|AFH08821.1| manganese superoxide dismutase 1, partial [Diospy... 66 4e-12 gb|ACJ73901.1| MnSOD 1-1, partial [Solanum nigrum] 66 5e-12 gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] 69 7e-12 ref|XP_011076593.1| PREDICTED: superoxide dismutase [Mn], mitoch... 69 8e-12 gb|KJB72988.1| hypothetical protein B456_011G207900 [Gossypium r... 69 9e-12 gb|ACU52584.1| manganese superoxide dismutase [Lantana camara] 69 1e-11 gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] 69 1e-11 sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], ... 69 1e-11 gb|KJB72989.1| hypothetical protein B456_011G207900 [Gossypium r... 69 1e-11 ref|XP_010670629.1| PREDICTED: superoxide dismutase [Mn], mitoch... 69 1e-11 gb|ABA00455.1| MnSOD [Gossypium hirsutum] 69 1e-11 ref|XP_012456160.1| PREDICTED: superoxide dismutase [Mn], mitoch... 69 1e-11 gb|KHG11516.1| Superoxide dismutase [Mn], mitochondrial [Gossypi... 69 1e-11 >gb|ACJ73902.1| MnSOD2, partial [Solanum nigrum] Length = 38 Score = 67.8 bits (164), Expect = 4e-13 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKV+NWKYA+EVYDK Sbjct: 6 YLQYKNVRPDYLKNIWKVMNWKYAAEVYDK 35 >emb|CAC19487.1| manganese superoxide dismutase 2 [Prunus persica] Length = 80 Score = 68.6 bits (166), Expect = 5e-13 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 48 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 77 >gb|AIZ49390.1| Mn superoxide dismutase 1, partial [Rosa hybrid cultivar] Length = 61 Score = 67.4 bits (163), Expect = 9e-13 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYAS+VY+K Sbjct: 29 YLQYKNVRPDYLKNIWKVINWKYASQVYEK 58 >ref|XP_011084834.1| PREDICTED: superoxide dismutase [Mn], mitochondrial isoform X2 [Sesamum indicum] Length = 89 Score = 67.8 bits (164), Expect = 1e-12 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKV+NWKYAS+VYDK Sbjct: 57 YLQYKNVRPDYLKNIWKVMNWKYASDVYDK 86 >gb|KYP69459.1| hypothetical protein KK1_008649, partial [Cajanus cajan] Length = 133 Score = 68.6 bits (166), Expect = 2e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 101 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 130 >gb|AKN79289.1| superoxide dismutase 4 [Betula platyphylla] Length = 225 Score = 70.1 bits (170), Expect = 3e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVYDK Sbjct: 193 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 222 >emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] Length = 224 Score = 69.7 bits (169), Expect = 4e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASE+YDK Sbjct: 192 YLQYKNVRPDYLKNIWKVINWKYASEIYDK 221 >gb|AFH08821.1| manganese superoxide dismutase 1, partial [Diospyros oleifera] Length = 79 Score = 66.2 bits (160), Expect = 4e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYL NIWKVINWKYASEVY+K Sbjct: 47 YLQYKNVRPDYLTNIWKVINWKYASEVYEK 76 >gb|ACJ73901.1| MnSOD 1-1, partial [Solanum nigrum] Length = 87 Score = 66.2 bits (160), Expect = 5e-12 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKV+NWKYA+EVY+K Sbjct: 55 YLQYKNVRPDYLKNIWKVMNWKYAAEVYEK 84 >gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] Length = 198 Score = 68.6 bits (166), Expect = 7e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 166 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 195 >ref|XP_011076593.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Sesamum indicum] Length = 225 Score = 68.9 bits (167), Expect = 8e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVYD+ Sbjct: 193 YLQYKNVRPDYLKNIWKVINWKYASEVYDR 222 >gb|KJB72988.1| hypothetical protein B456_011G207900 [Gossypium raimondii] Length = 213 Score = 68.6 bits (166), Expect = 9e-12 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 181 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 210 >gb|ACU52584.1| manganese superoxide dismutase [Lantana camara] Length = 224 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDKAL 284 YLQYKNVRPDYLKNIWKV+NWKYASEVY+K L Sbjct: 192 YLQYKNVRPDYLKNIWKVMNWKYASEVYEKEL 223 >gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] Length = 226 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 194 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 223 >sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|6006619|emb|CAB56851.1| manganese superoxide dismutase 1 [Prunus persica] Length = 228 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 196 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 225 >gb|KJB72989.1| hypothetical protein B456_011G207900 [Gossypium raimondii] Length = 230 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 198 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 227 >ref|XP_010670629.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870865747|gb|KMT16785.1| hypothetical protein BVRB_2g042720 [Beta vulgaris subsp. vulgaris] Length = 230 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 196 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 225 >gb|ABA00455.1| MnSOD [Gossypium hirsutum] Length = 231 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 199 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 228 >ref|XP_012456160.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Gossypium raimondii] gi|763806049|gb|KJB72987.1| hypothetical protein B456_011G207900 [Gossypium raimondii] Length = 231 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 199 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 228 >gb|KHG11516.1| Superoxide dismutase [Mn], mitochondrial [Gossypium arboreum] Length = 231 Score = 68.6 bits (166), Expect = 1e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 379 YLQYKNVRPDYLKNIWKVINWKYASEVYDK 290 YLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 199 YLQYKNVRPDYLKNIWKVINWKYASEVYEK 228