BLASTX nr result
ID: Rehmannia28_contig00013179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013179 (1160 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH52976.1| Armadillo-type fold [Cynara cardunculus var. scol... 59 7e-06 ref|XP_012827513.1| PREDICTED: serine/threonine-protein phosphat... 59 9e-06 >gb|KVH52976.1| Armadillo-type fold [Cynara cardunculus var. scolymus] Length = 811 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +2 Query: 149 DNPKVHANAAETLCTITRYAPPRLASKISRPRLRFVIYL 265 D P+VH NAAE+LC ITRYAPP LA+KIS PRL F+ L Sbjct: 245 DCPEVHGNAAESLCAITRYAPPGLATKISSPRLAFIFIL 283 >ref|XP_012827513.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Erythranthe guttata] gi|848927542|ref|XP_012827514.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory subunit 3-like [Erythranthe guttata] gi|604299194|gb|EYU19129.1| hypothetical protein MIMGU_mgv1a001633mg [Erythranthe guttata] Length = 781 Score = 58.5 bits (140), Expect = 9e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 134 QYLLQDNPKVHANAAETLCTITRYAPPRLASKISRP 241 +Y D+P+VHANAAETLC ITRYAPP LASKIS P Sbjct: 200 KYSSSDSPEVHANAAETLCAITRYAPPGLASKISSP 235