BLASTX nr result
ID: Rehmannia28_contig00013072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013072 (469 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR26076.1| 60S ribosomal protein l15, partial [Oryza sativa ... 77 5e-16 ref|XP_006470979.1| PREDICTED: 60S ribosomal protein L15-like [C... 79 1e-15 ref|XP_015879490.1| PREDICTED: 60S ribosomal protein L15-2-like ... 77 1e-15 ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform... 79 2e-15 emb|CDP11952.1| unnamed protein product [Coffea canephora] 79 2e-15 gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sin... 79 2e-15 gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sin... 79 3e-15 gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlise... 79 3e-15 gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlise... 79 3e-15 ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [S... 79 3e-15 ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [S... 79 3e-15 ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [S... 79 3e-15 ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamu... 79 3e-15 ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like ... 79 3e-15 ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [E... 79 3e-15 ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elae... 79 3e-15 ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform... 79 3e-15 ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [N... 79 3e-15 ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicoti... 79 3e-15 ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa... 79 3e-15 >gb|ABR26076.1| 60S ribosomal protein l15, partial [Oryza sativa Indica Group] Length = 58 Score = 76.6 bits (187), Expect = 5e-16 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGH HHKARPSRRATWKRNQT Sbjct: 17 GLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNQT 51 >ref|XP_006470979.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis] Length = 164 Score = 78.6 bits (192), Expect = 1e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 123 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 157 >ref|XP_015879490.1| PREDICTED: 60S ribosomal protein L15-2-like [Ziziphus jujuba] Length = 99 Score = 76.6 bits (187), Expect = 1e-15 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRN T Sbjct: 58 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNT 92 >ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis] Length = 186 Score = 78.6 bits (192), Expect = 2e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 145 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 179 >emb|CDP11952.1| unnamed protein product [Coffea canephora] Length = 186 Score = 78.6 bits (192), Expect = 2e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 145 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 179 >gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis] Length = 186 Score = 78.6 bits (192), Expect = 2e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 145 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 179 >gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis] Length = 195 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 154 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 188 >gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea] Length = 203 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 162 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 196 >gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea] Length = 203 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 162 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 196 >ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] gi|747059967|ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis] gi|697184864|ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis] gi|698453919|ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197 >ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. malaccensis] Length = 204 Score = 78.6 bits (192), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 468 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 364 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT Sbjct: 163 GLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQT 197