BLASTX nr result
ID: Rehmannia28_contig00012081
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012081 (363 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835160.1| PREDICTED: B3 domain-containing protein Os01... 59 1e-07 >ref|XP_012835160.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Erythranthe guttata] gi|604335409|gb|EYU39334.1| hypothetical protein MIMGU_mgv1a005357mg [Erythranthe guttata] Length = 487 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 2 AKLVELKELYAKCDQDIGDLKKKAERYEVVFREAVNASW 118 AK+ ELKE AKCD+DI +LK +AERYEV+FRE V+ASW Sbjct: 449 AKISELKEFSAKCDRDIENLKTRAERYEVMFREEVSASW 487