BLASTX nr result
ID: Rehmannia28_contig00012080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012080 (466 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835160.1| PREDICTED: B3 domain-containing protein Os01... 54 8e-06 >ref|XP_012835160.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Erythranthe guttata] gi|604335409|gb|EYU39334.1| hypothetical protein MIMGU_mgv1a005357mg [Erythranthe guttata] Length = 487 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 AKLVELKELYAKYDQDIGDLKKKAERYEVVFREAVNASW 118 AK+ ELKE AK D+DI +LK +AERYEV+FRE V+ASW Sbjct: 449 AKISELKEFSAKCDRDIENLKTRAERYEVMFREEVSASW 487