BLASTX nr result
ID: Rehmannia28_contig00009042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009042 (383 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41154.1| hypothetical protein MIMGU_mgv1a022442mg, partial... 57 2e-07 gb|EYU44923.1| hypothetical protein MIMGU_mgv1a0232221mg, partia... 54 5e-07 ref|XP_012848406.1| PREDICTED: putative FBD-associated F-box pro... 54 7e-06 >gb|EYU41154.1| hypothetical protein MIMGU_mgv1a022442mg, partial [Erythranthe guttata] Length = 200 Score = 57.0 bits (136), Expect = 2e-07 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +2 Query: 2 YLLRNAQVLKKMEIFSGPDGIDFESKFNALQRISSFQRGSVACELGFF*DCVGV 163 Y+LRNA+VL+ MEI G I FE KFN LQ IS F+RGS ACE+ F D G+ Sbjct: 138 YVLRNAKVLETMEIAHG-SCIGFEKKFNMLQEISRFRRGSTACEVAFVRDVKGL 190 >gb|EYU44923.1| hypothetical protein MIMGU_mgv1a0232221mg, partial [Erythranthe guttata] Length = 93 Score = 53.5 bits (127), Expect = 5e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +2 Query: 2 YLLRNAQVLKKMEIFSGPDGIDFESKFNALQRISSFQRGSVACELGF 142 YLLRN++VL +MEI G + +D+E K + +Q+IS FQRGS ACE+ F Sbjct: 43 YLLRNSKVLNRMEIAYG-ELVDYEEKLDMVQKISLFQRGSAACEVAF 88 >ref|XP_012848406.1| PREDICTED: putative FBD-associated F-box protein At5g56440 [Erythranthe guttata] Length = 401 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +2 Query: 2 YLLRNAQVLKKMEIFSGPDGIDFESKFNALQRISSFQRGSVACELGF 142 YLLRN++VL +MEI G + +D+E K + +Q+IS FQRGS ACE+ F Sbjct: 351 YLLRNSKVLNRMEIAYG-ELVDYEEKLDMVQKISLFQRGSAACEVAF 396