BLASTX nr result
ID: Rehmannia28_contig00008589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00008589 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Erythra... 64 3e-10 >gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Erythranthe guttata] Length = 166 Score = 63.5 bits (153), Expect = 3e-10 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = -2 Query: 159 MKIWCFPFLCFGEREEES-VTSG-NLYYFYCSNKGKEHIRKGDLGNVSEEMENDD 1 MKI CFPFLCFG EE++ + SG + Y CS++GKE R+G LGN SEEME DD Sbjct: 1 MKICCFPFLCFGIGEEDNNICSGRDTCYLLCSSEGKESTREGILGNESEEMEQDD 55