BLASTX nr result
ID: Rehmannia28_contig00008588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00008588 (347 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Erythra... 61 2e-09 >gb|EYU32324.1| hypothetical protein MIMGU_mgv1a000960mg [Erythranthe guttata] Length = 166 Score = 60.8 bits (146), Expect = 2e-09 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -2 Query: 226 MKIWCFPFLCFGEREEESVTSGNLYSFY--CSNKGKEHIRKGDLGNVSEEMENDDSRL 59 MKI CFPFLCFG EE++ + Y CS++GKE R+G LGN SEEME DD L Sbjct: 1 MKICCFPFLCFGIGEEDNNICSGRDTCYLLCSSEGKESTREGILGNESEEMEQDDLNL 58