BLASTX nr result
ID: Rehmannia28_contig00007734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00007734 (326 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843622.1| PREDICTED: fasciclin-like arabinogalactan pr... 84 5e-17 ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan pr... 84 7e-17 gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partia... 73 4e-13 ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citr... 71 2e-12 ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan pr... 71 3e-12 dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein ... 68 5e-12 dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein ... 68 5e-12 dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein ... 68 5e-12 ref|XP_015061037.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 8e-12 ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 8e-12 ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan pr... 70 8e-12 dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein ... 67 9e-12 ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan pr... 69 1e-11 emb|CDP17792.1| unnamed protein product [Coffea canephora] 69 1e-11 ref|XP_002511740.1| PREDICTED: fasciclin-like arabinogalactan pr... 69 2e-11 ref|XP_012083547.1| PREDICTED: fasciclin-like arabinogalactan pr... 68 3e-11 ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan pr... 67 7e-11 ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 pre... 67 7e-11 ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prun... 67 7e-11 ref|XP_010545153.1| PREDICTED: fasciclin-like arabinogalactan pr... 66 1e-10 >ref|XP_012843622.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Erythranthe guttata] gi|604321438|gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata] Length = 422 Score = 84.3 bits (207), Expect = 5e-17 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEIL YPEYSEFN+LL+QTKLADEINSREPVTVCVLPNGAL Sbjct: 25 NITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVLPNGAL 68 >ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum indicum] Length = 426 Score = 84.0 bits (206), Expect = 7e-17 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILS +PEYSEFN LL+QTKLADEINSREPVTVCVLPNGAL Sbjct: 25 NITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGAL 68 >gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea aurea] Length = 400 Score = 73.2 bits (178), Expect = 4e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL AYPEYS+FN+LLTQTKLADEI+SREPVTV LPN L Sbjct: 3 NITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSEL 46 >ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina] gi|985467407|ref|XP_006491459.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Citrus sinensis] gi|557547488|gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina] gi|641867185|gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis] Length = 418 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL +PEYS+FNS LTQTKLADEINSR+ +TV VLPNGA+ Sbjct: 22 NITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAM 65 >ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana tomentosiformis] Length = 422 Score = 70.9 bits (172), Expect = 3e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILS +PEYSEFNS LTQTKLADEINSR+ +TV L NGA+ Sbjct: 22 NITEILSKFPEYSEFNSYLTQTKLADEINSRQTITVLALTNGAM 65 >dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] gi|661902362|dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL +PEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 14 NITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL +PEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 14 NITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] gi|661902356|dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL +PEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 14 NITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >ref|XP_015061037.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum pennellii] Length = 414 Score = 69.7 bits (169), Expect = 8e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEIL+ +PEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 20 NITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum lycopersicum] Length = 414 Score = 69.7 bits (169), Expect = 8e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEIL+ +PEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 20 NITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum tuberosum] Length = 415 Score = 69.7 bits (169), Expect = 8e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEIL+ +PEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 20 NITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 67.4 bits (163), Expect = 9e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+IL +PEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 14 NITDILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAM 57 >ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana sylvestris] Length = 422 Score = 69.3 bits (168), Expect = 1e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILS +PEYSEFNS LTQTKLADEINSR +T+ L NGA+ Sbjct: 22 NITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTNGAM 65 >emb|CDP17792.1| unnamed protein product [Coffea canephora] Length = 460 Score = 68.9 bits (167), Expect = 1e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILSA+PEYSE+N LT TKLADEINSRE +TV VL N A+ Sbjct: 64 NITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAM 107 >ref|XP_002511740.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Ricinus communis] gi|223548920|gb|EEF50409.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+ILS +P+YSEFN LTQTKLADEINSRE +TV L NGA+ Sbjct: 25 NITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNGAM 68 >ref|XP_012083547.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Jatropha curcas] gi|643717108|gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas] Length = 423 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+ILS +P+YSEFN LTQTKLADEINSRE +TV L NGA+ Sbjct: 23 NITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNGAI 66 >ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus euphratica] Length = 421 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+ILS +PEYSEFN LTQTKLADEIN+R+ +TV L NGA+ Sbjct: 25 NITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAM 68 >ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa] gi|222861509|gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa] Length = 421 Score = 67.0 bits (162), Expect = 7e-11 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NIT+ILS +PEYSEFN LTQTKLADEIN+R+ +TV L NGA+ Sbjct: 25 NITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAM 68 >ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica] gi|462414514|gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica] Length = 425 Score = 67.0 bits (162), Expect = 7e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILSA+P+YS++NS LTQTKLADEIN+R+ +T+ VL N A+ Sbjct: 25 NITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAI 68 >ref|XP_010545153.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Tarenaya hassleriana] Length = 445 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +3 Query: 195 NITEILSAYPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 NITEILS P+YS+FNS LTQT+LADEINSR +TV VL NGA+ Sbjct: 27 NITEILSGSPDYSQFNSYLTQTRLADEINSRTTITVLVLSNGAM 70