BLASTX nr result
ID: Rehmannia28_contig00007730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00007730 (326 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843622.1| PREDICTED: fasciclin-like arabinogalactan pr... 79 3e-15 ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan pr... 79 3e-15 ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citr... 67 9e-11 ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan pr... 66 1e-10 gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partia... 66 2e-10 dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein ... 64 3e-10 dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein ... 64 3e-10 dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein ... 64 3e-10 ref|XP_015061037.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 3e-10 ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 3e-10 ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 3e-10 ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan pr... 65 4e-10 dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein ... 63 5e-10 emb|CDP17792.1| unnamed protein product [Coffea canephora] 64 6e-10 ref|XP_002511740.1| PREDICTED: fasciclin-like arabinogalactan pr... 64 8e-10 ref|XP_012083547.1| PREDICTED: fasciclin-like arabinogalactan pr... 64 1e-09 ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan pr... 62 3e-09 ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 pre... 62 3e-09 ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prun... 62 3e-09 gb|KVH97207.1| FAS1 domain-containing protein [Cynara cardunculu... 61 7e-09 >ref|XP_012843622.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Erythranthe guttata] gi|604321438|gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata] Length = 422 Score = 79.3 bits (194), Expect = 3e-15 Identities = 44/68 (64%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +3 Query: 129 MAASFTFSL--VXXXXXXXXXXXXXXXEILSAFPEYSEFNSLLTQTKLADEINSREPVTV 302 MAAS T SL V EIL +PEYSEFN+LL+QTKLADEINSREPVTV Sbjct: 1 MAASLTLSLLAVVTLAAVSIAAATNITEILDGYPEYSEFNTLLSQTKLADEINSREPVTV 60 Query: 303 CVLPNGAL 326 CVLPNGAL Sbjct: 61 CVLPNGAL 68 >ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum indicum] Length = 426 Score = 79.3 bits (194), Expect = 3e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EILS FPEYSEFN LL+QTKLADEINSREPVTVCVLPNGAL Sbjct: 28 EILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGAL 68 >ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina] gi|985467407|ref|XP_006491459.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Citrus sinensis] gi|557547488|gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina] gi|641867185|gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis] Length = 418 Score = 66.6 bits (161), Expect = 9e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL FPEYS+FNS LTQTKLADEINSR+ +TV VLPNGA+ Sbjct: 25 DILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAM 65 >ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana tomentosiformis] Length = 422 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EILS FPEYSEFNS LTQTKLADEINSR+ +TV L NGA+ Sbjct: 25 EILSKFPEYSEFNSYLTQTKLADEINSRQTITVLALTNGAM 65 >gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea aurea] Length = 400 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL A+PEYS+FN+LLTQTKLADEI+SREPVTV LPN L Sbjct: 6 KILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSEL 46 >dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] gi|661902362|dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 63.5 bits (153), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL FPEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 17 DILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 63.5 bits (153), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL FPEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 17 DILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] gi|661902356|dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 63.5 bits (153), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL FPEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 17 DILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAM 57 >ref|XP_015061037.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum pennellii] Length = 414 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EIL+ FPEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 23 EILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum lycopersicum] Length = 414 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EIL+ FPEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 23 EILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum tuberosum] Length = 415 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EIL+ FPEYS FNS L+QTKLADEINSRE +TV LPNGA+ Sbjct: 23 EILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAM 63 >ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana sylvestris] Length = 422 Score = 64.7 bits (156), Expect = 4e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EILS FPEYSEFNS LTQTKLADEINSR +T+ L NGA+ Sbjct: 25 EILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTNGAM 65 >dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum ailanthoides] Length = 188 Score = 62.8 bits (151), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +IL FPEYS+FNS L+QTKLADEINSR+ +TV LPNGA+ Sbjct: 17 DILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAM 57 >emb|CDP17792.1| unnamed protein product [Coffea canephora] Length = 460 Score = 64.3 bits (155), Expect = 6e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EILSAFPEYSE+N LT TKLADEINSRE +TV VL N A+ Sbjct: 67 EILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAM 107 >ref|XP_002511740.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Ricinus communis] gi|223548920|gb|EEF50409.1| conserved hypothetical protein [Ricinus communis] Length = 425 Score = 63.9 bits (154), Expect = 8e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +ILS FP+YSEFN LTQTKLADEINSRE +TV L NGA+ Sbjct: 28 DILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNGAM 68 >ref|XP_012083547.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Jatropha curcas] gi|643717108|gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas] Length = 423 Score = 63.5 bits (153), Expect = 1e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +ILS FP+YSEFN LTQTKLADEINSRE +TV L NGA+ Sbjct: 26 DILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNGAI 66 >ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus euphratica] Length = 421 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +ILS FPEYSEFN LTQTKLADEIN+R+ +TV L NGA+ Sbjct: 28 DILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAM 68 >ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa] gi|222861509|gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa] Length = 421 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 +ILS FPEYSEFN LTQTKLADEIN+R+ +TV L NGA+ Sbjct: 28 DILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAM 68 >ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica] gi|462414514|gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica] Length = 425 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 204 EILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 EILSAFP+YS++NS LTQTKLADEIN+R+ +T+ VL N A+ Sbjct: 28 EILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAI 68 >gb|KVH97207.1| FAS1 domain-containing protein [Cynara cardunculus var. scolymus] Length = 425 Score = 61.2 bits (147), Expect = 7e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 207 ILSAFPEYSEFNSLLTQTKLADEINSREPVTVCVLPNGAL 326 ILS FPEYSEFN+ L+QTKL DEINSRE +TV VL NGA+ Sbjct: 29 ILSQFPEYSEFNNYLSQTKLDDEINSRETITVLVLNNGAV 68