BLASTX nr result
ID: Rehmannia28_contig00007567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00007567 (336 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071081.1| PREDICTED: probable xyloglucan endotransgluc... 65 2e-10 ref|XP_006355979.2| PREDICTED: probable xyloglucan endotransgluc... 63 1e-09 ref|XP_009804330.1| PREDICTED: probable xyloglucan endotransgluc... 62 4e-09 ref|XP_009623898.1| PREDICTED: probable xyloglucan endotransgluc... 62 4e-09 ref|XP_009795133.1| PREDICTED: probable xyloglucan endotransgluc... 62 5e-09 gb|EYU22485.1| hypothetical protein MIMGU_mgv1a023829mg, partial... 61 6e-09 ref|XP_004238674.1| PREDICTED: probable xyloglucan endotransgluc... 61 7e-09 ref|XP_012855354.1| PREDICTED: probable xyloglucan endotransgluc... 61 7e-09 ref|XP_015075129.1| PREDICTED: probable xyloglucan endotransgluc... 61 7e-09 emb|CDP00178.1| unnamed protein product [Coffea canephora] 59 3e-08 ref|XP_015957064.1| PREDICTED: probable xyloglucan endotransgluc... 58 9e-08 gb|AFK37086.1| unknown [Lotus japonicus] 58 1e-07 ref|XP_011086549.1| PREDICTED: probable xyloglucan endotransgluc... 57 3e-07 gb|ABA54988.1| xyloglucan endotransglycosylase hydrolase [Apium ... 56 4e-07 gb|KHN39740.1| Putative xyloglucan endotransglucosylase/hydrolas... 56 4e-07 gb|KHN10598.1| Putative xyloglucan endotransglucosylase/hydrolas... 56 4e-07 ref|XP_007153638.1| hypothetical protein PHAVU_003G052400g [Phas... 56 4e-07 gb|KYP54889.1| putative xyloglucan endotransglucosylase/hydrolas... 56 4e-07 ref|XP_003552017.2| PREDICTED: probable xyloglucan endotransgluc... 56 4e-07 ref|XP_014523598.1| PREDICTED: probable xyloglucan endotransgluc... 56 6e-07 >ref|XP_011071081.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Sesamum indicum] Length = 312 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHA 250 LDWARRKHMFYSYCQDK RYKVLPPEC+A Sbjct: 282 LDWARRKHMFYSYCQDKNRYKVLPPECNA 310 >ref|XP_006355979.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum tuberosum] Length = 323 Score = 63.2 bits (152), Expect = 1e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHA 250 LDWARRKHMFYSYCQD RYKVLPPEC+A Sbjct: 294 LDWARRKHMFYSYCQDTKRYKVLPPECNA 322 >ref|XP_009804330.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana sylvestris] Length = 316 Score = 62.0 bits (149), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHA 250 LDWARRKHMFYSYCQD RYKVLPPEC A Sbjct: 287 LDWARRKHMFYSYCQDTRRYKVLPPECTA 315 >ref|XP_009623898.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana tomentosiformis] Length = 316 Score = 62.0 bits (149), Expect = 4e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHA 250 LDWARRKHMFYSYCQD RYKVLPPEC A Sbjct: 287 LDWARRKHMFYSYCQDTRRYKVLPPECTA 315 >ref|XP_009795133.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana sylvestris] Length = 316 Score = 61.6 bits (148), Expect = 5e-09 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHAN 247 LDW RRKHMFYSYCQD RYKVLPPEC +N Sbjct: 287 LDWVRRKHMFYSYCQDTNRYKVLPPECTSN 316 >gb|EYU22485.1| hypothetical protein MIMGU_mgv1a023829mg, partial [Erythranthe guttata] Length = 289 Score = 61.2 bits (147), Expect = 6e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHAN 247 LDWARRKHMFYSYCQDK RYKVLP EC+++ Sbjct: 260 LDWARRKHMFYSYCQDKSRYKVLPRECNSS 289 >ref|XP_004238674.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum lycopersicum] Length = 313 Score = 61.2 bits (147), Expect = 7e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPEC 256 LDWARRKHMFYSYCQD RYKVLPPEC Sbjct: 284 LDWARRKHMFYSYCQDTKRYKVLPPEC 310 >ref|XP_012855354.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Erythranthe guttata] Length = 314 Score = 61.2 bits (147), Expect = 7e-09 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHAN 247 LDWARRKHMFYSYCQDK RYKVLP EC+++ Sbjct: 285 LDWARRKHMFYSYCQDKSRYKVLPRECNSS 314 >ref|XP_015075129.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum pennellii] Length = 316 Score = 61.2 bits (147), Expect = 7e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPEC 256 LDWARRKHMFYSYCQD RYKVLPPEC Sbjct: 287 LDWARRKHMFYSYCQDTKRYKVLPPEC 313 >emb|CDP00178.1| unnamed protein product [Coffea canephora] Length = 311 Score = 59.3 bits (142), Expect = 3e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPEC 256 L+WAR KHMFYSYCQDK RYKVLPPEC Sbjct: 281 LEWARGKHMFYSYCQDKSRYKVLPPEC 307 >ref|XP_015957064.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Arachis duranensis] Length = 305 Score = 58.2 bits (139), Expect = 9e-08 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 LDWAR+K MFYSYC DK RYKV+PPECH Sbjct: 278 LDWARKKLMFYSYCTDKNRYKVMPPECH 305 >gb|AFK37086.1| unknown [Lotus japonicus] Length = 309 Score = 57.8 bits (138), Expect = 1e-07 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC DK R+KVLPPECH Sbjct: 282 MDWARRKLMFYSYCNDKPRFKVLPPECH 309 >ref|XP_011086549.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Sesamum indicum] Length = 314 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECHA 250 L+WAR KHMFYSYCQDK RYKVLP EC A Sbjct: 285 LNWARGKHMFYSYCQDKSRYKVLPAECTA 313 >gb|ABA54988.1| xyloglucan endotransglycosylase hydrolase [Apium graveolens] Length = 307 Score = 56.2 bits (134), Expect = 4e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRKHMFYSYC+D RYKVLP EC+ Sbjct: 278 MDWARRKHMFYSYCKDTSRYKVLPAECN 305 >gb|KHN39740.1| Putative xyloglucan endotransglucosylase/hydrolase protein 33 [Glycine soja] Length = 310 Score = 56.2 bits (134), Expect = 4e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC D+ R+KV+PPECH Sbjct: 283 MDWARRKLMFYSYCNDRSRFKVMPPECH 310 >gb|KHN10598.1| Putative xyloglucan endotransglucosylase/hydrolase protein 33 [Glycine soja] Length = 311 Score = 56.2 bits (134), Expect = 4e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC D+ R+KV+PPECH Sbjct: 284 MDWARRKLMFYSYCNDRSRFKVMPPECH 311 >ref|XP_007153638.1| hypothetical protein PHAVU_003G052400g [Phaseolus vulgaris] gi|561026992|gb|ESW25632.1| hypothetical protein PHAVU_003G052400g [Phaseolus vulgaris] Length = 311 Score = 56.2 bits (134), Expect = 4e-07 Identities = 21/28 (75%), Positives = 26/28 (92%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC+D+ R+KV+PPECH Sbjct: 284 MDWARRKLMFYSYCKDRPRFKVMPPECH 311 >gb|KYP54889.1| putative xyloglucan endotransglucosylase/hydrolase protein 33 [Cajanus cajan] Length = 314 Score = 56.2 bits (134), Expect = 4e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC D+ R+KV+PPECH Sbjct: 287 MDWARRKLMFYSYCNDRSRFKVMPPECH 314 >ref|XP_003552017.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Glycine max] gi|947049801|gb|KRG99329.1| hypothetical protein GLYMA_18G137500 [Glycine max] Length = 320 Score = 56.2 bits (134), Expect = 4e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC D+ R+KV+PPECH Sbjct: 293 MDWARRKLMFYSYCNDRSRFKVMPPECH 320 >ref|XP_014523598.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Vigna radiata var. radiata] Length = 311 Score = 55.8 bits (133), Expect = 6e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 336 LDWARRKHMFYSYCQDKYRYKVLPPECH 253 +DWARRK MFYSYC D+ R+KV+PPECH Sbjct: 284 MDWARRKLMFYSYCNDRPRFKVMPPECH 311