BLASTX nr result
ID: Rehmannia28_contig00006715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00006715 (834 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097925.1| PREDICTED: autophagy-related protein 18f [Se... 70 5e-10 ref|XP_012841721.1| PREDICTED: autophagy-related protein 18f iso... 59 2e-06 ref|XP_012841720.1| PREDICTED: autophagy-related protein 18f iso... 59 2e-06 ref|XP_012841719.1| PREDICTED: autophagy-related protein 18f iso... 59 3e-06 >ref|XP_011097925.1| PREDICTED: autophagy-related protein 18f [Sesamum indicum] Length = 893 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 674 MRNDSQRSGDGGALVPLSGRVNNGIIPNSFKALSSYLRI 790 MRND Q+SGDGGALVP GR NNGIIPNSFKALSSYLR+ Sbjct: 1 MRNDGQKSGDGGALVPRPGRGNNGIIPNSFKALSSYLRV 39 >ref|XP_012841721.1| PREDICTED: autophagy-related protein 18f isoform X3 [Erythranthe guttata] Length = 741 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = +2 Query: 674 MRNDSQRSGDGG--ALVPLS--GRVNNGIIPNSFKALSSYLRI 790 MRND Q+SGDGG A+VP S GR NNGIIPNSFK LSSYL+I Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKI 43 >ref|XP_012841720.1| PREDICTED: autophagy-related protein 18f isoform X2 [Erythranthe guttata] Length = 812 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = +2 Query: 674 MRNDSQRSGDGG--ALVPLS--GRVNNGIIPNSFKALSSYLRI 790 MRND Q+SGDGG A+VP S GR NNGIIPNSFK LSSYL+I Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKI 43 >ref|XP_012841719.1| PREDICTED: autophagy-related protein 18f isoform X1 [Erythranthe guttata] Length = 829 Score = 58.9 bits (141), Expect = 3e-06 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 4/43 (9%) Frame = +2 Query: 674 MRNDSQRSGDGG--ALVPLS--GRVNNGIIPNSFKALSSYLRI 790 MRND Q+SGDGG A+VP S GR NNGIIPNSFK LSSYL+I Sbjct: 1 MRNDGQKSGDGGGGAMVPRSSGGRGNNGIIPNSFKTLSSYLKI 43