BLASTX nr result
ID: Rehmannia28_contig00006559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00006559 (406 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30960.1| hypothetical protein MIMGU_mgv1a0166801mg, partia... 58 1e-08 >gb|EYU30960.1| hypothetical protein MIMGU_mgv1a0166801mg, partial [Erythranthe guttata] Length = 98 Score = 58.2 bits (139), Expect = 1e-08 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +2 Query: 275 KTYINATATSAAVRTVPPMAALLTNPLFEPSAGVPSAAGPG 397 KTYINATATS A + VPP AALLT PLF+ SAG S GPG Sbjct: 14 KTYINATATSPAAKAVPPTAALLTKPLFKLSAGGASPGGPG 54