BLASTX nr result
ID: Rehmannia28_contig00006151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00006151 (460 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF42761.1| conserved hypothetical protein [Ricinus communis] 85 3e-18 >gb|EEF42761.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 84.7 bits (208), Expect = 3e-18 Identities = 41/87 (47%), Positives = 64/87 (73%), Gaps = 1/87 (1%) Frame = +1 Query: 1 YDVDEMQDEEIHVDEFVSVENVVYQENDVNDTFEVSLGEIESLSRDDLDPEDIDESIIAK 180 YDVDE+QDE + +++ VE+ VYQEN++ND V L EI SL+R D+D +D++ II++ Sbjct: 46 YDVDEIQDEAMDLNDLALVEDEVYQENEINDIVIVDLSEIASLNRVDIDLKDVNSFIISE 105 Query: 181 IPEVAEITS-LDVDEEDEFDDTMIEYC 258 + E ++ + +DVDE DE DDT+++YC Sbjct: 106 LHEGSKDENIIDVDEFDETDDTLVDYC 132