BLASTX nr result
ID: Rehmannia28_contig00004964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00004964 (311 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015967111.1| PREDICTED: uncharacterized protein LOC107490... 55 1e-07 ref|XP_007203109.1| hypothetical protein PRUPE_ppa023846mg [Prun... 51 3e-06 ref|XP_012070364.1| PREDICTED: uncharacterized protein LOC105632... 50 4e-06 ref|XP_011047033.1| PREDICTED: uncharacterized protein LOC105141... 50 4e-06 ref|XP_012857234.1| PREDICTED: uncharacterized protein LOC105976... 50 6e-06 gb|KDO36742.1| hypothetical protein CISIN_1g034425mg [Citrus sin... 50 8e-06 gb|KDO36741.1| hypothetical protein CISIN_1g034425mg [Citrus sin... 50 8e-06 >ref|XP_015967111.1| PREDICTED: uncharacterized protein LOC107490812 [Arachis duranensis] Length = 95 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 300 ELELVEGRMNLGLADYPGTGANRNHDPRTPGR 205 E VEGRM+L DYPGTGANRNHDP+TPGR Sbjct: 63 EFMTVEGRMDLESNDYPGTGANRNHDPKTPGR 94 >ref|XP_007203109.1| hypothetical protein PRUPE_ppa023846mg [Prunus persica] gi|462398640|gb|EMJ04308.1| hypothetical protein PRUPE_ppa023846mg [Prunus persica] Length = 90 Score = 50.8 bits (120), Expect = 3e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -3 Query: 288 VEGRMNLGLADYPGTGANRNHDPRTPGR 205 +EGRM++ DYPGTGAN +HDPRTPGR Sbjct: 62 IEGRMDMESTDYPGTGANNHHDPRTPGR 89 >ref|XP_012070364.1| PREDICTED: uncharacterized protein LOC105632565 [Jatropha curcas] Length = 91 Score = 50.4 bits (119), Expect = 4e-06 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 4/38 (10%) Frame = -3 Query: 306 DDELELVEG----RMNLGLADYPGTGANRNHDPRTPGR 205 +++L+L+EG RM+L DYPGTGAN +HDP+TPGR Sbjct: 53 EEQLDLIEGDMNGRMDLESQDYPGTGANNHHDPKTPGR 90 >ref|XP_011047033.1| PREDICTED: uncharacterized protein LOC105141499 [Populus euphratica] Length = 92 Score = 50.4 bits (119), Expect = 4e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -3 Query: 288 VEGRMNLGLADYPGTGANRNHDPRTPGR 205 +EGRM+L DYPGTGAN +HDP+TPGR Sbjct: 64 IEGRMDLQSTDYPGTGANNHHDPKTPGR 91 >ref|XP_012857234.1| PREDICTED: uncharacterized protein LOC105976546 [Erythranthe guttata] gi|604301157|gb|EYU20877.1| hypothetical protein MIMGU_mgv1a017313mg [Erythranthe guttata] Length = 82 Score = 49.7 bits (117), Expect = 6e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 294 ELVEGRMNLGLADYPGTGANRNHDPRTP 211 +LVEGRM + LADYPGTGAN NHDP P Sbjct: 53 KLVEGRMEMELADYPGTGANHNHDPTPP 80 >gb|KDO36742.1| hypothetical protein CISIN_1g034425mg [Citrus sinensis] Length = 94 Score = 49.7 bits (117), Expect = 8e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 288 VEGRMNLGLADYPGTGANRNHDPRTPGR 205 +EGRM++ DYPGTGAN +HDP+TPGR Sbjct: 66 IEGRMDMESTDYPGTGANNHHDPKTPGR 93 >gb|KDO36741.1| hypothetical protein CISIN_1g034425mg [Citrus sinensis] Length = 95 Score = 49.7 bits (117), Expect = 8e-06 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 288 VEGRMNLGLADYPGTGANRNHDPRTPGR 205 +EGRM++ DYPGTGAN +HDP+TPGR Sbjct: 67 IEGRMDMESTDYPGTGANNHHDPKTPGR 94