BLASTX nr result
ID: Rehmannia28_contig00004491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00004491 (435 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 75 1e-15 ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709... 76 1e-15 ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980... 74 3e-15 ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165... 73 6e-15 ref|XP_015958167.1| PREDICTED: uncharacterized protein LOC107482... 73 8e-15 ref|XP_012844994.1| PREDICTED: uncharacterized protein LOC105965... 73 8e-15 ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 73 8e-15 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 72 1e-14 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 72 1e-14 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 72 2e-14 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 72 2e-14 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 72 2e-14 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 71 3e-14 ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261... 71 4e-14 ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987... 70 6e-14 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 70 1e-13 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 69 2e-13 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 69 2e-13 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 69 3e-13 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 69 3e-13 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] gi|723672381|ref|XP_010316390.1| PREDICTED: uncharacterized protein LOC104645744 [Solanum lycopersicum] Length = 41 Score = 75.1 bits (183), Expect = 1e-15 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 M+PV+SE+LLSG TINST R G+HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709303 [Phoenix dactylifera] Length = 92 Score = 76.3 bits (186), Expect = 1e-15 Identities = 39/53 (73%), Positives = 42/53 (79%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS*TKFSIIN*LVH 39 MSP+LSEI LSG INSTFRH +HLVQSFSVVFLYWFYVFS S I+ L H Sbjct: 1 MSPILSEIFLSGFMINSTFRHPTHLVQSFSVVFLYWFYVFSRGVSSSISVLGH 53 >ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980141 [Musa acuminata subsp. malaccensis] Length = 57 Score = 74.3 bits (181), Expect = 3e-15 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSP+LSEILLSG INST RH +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGCMINSTIRHRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165758 [Sesamum indicum] Length = 43 Score = 73.2 bits (178), Expect = 6e-15 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 200 VMSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 +MS VLSEILLSG T+NST R SHLVQSFSVVFLYWFYVFS Sbjct: 2 IMSAVLSEILLSGFTVNSTLRRRSHLVQSFSVVFLYWFYVFS 43 >ref|XP_015958167.1| PREDICTED: uncharacterized protein LOC107482251 [Arachis duranensis] gi|1012175984|ref|XP_015966939.1| PREDICTED: uncharacterized protein LOC107490651 [Arachis duranensis] Length = 41 Score = 72.8 bits (177), Expect = 8e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPV+ EILLSG TINST R SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVICEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_012844994.1| PREDICTED: uncharacterized protein LOC105965030 [Erythranthe guttata] Length = 41 Score = 72.8 bits (177), Expect = 8e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPVLSEILLSG T+NS R GSHLVQS SVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSALRLGSHLVQSLSVVFLYWFYVFS 41 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 72.8 bits (177), Expect = 8e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSP+LSEILLSG INST R SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 72.4 bits (176), Expect = 1e-14 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 200 VMSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 +MSPV+SE+LLSG TINST +HLVQSFSVVFLYWFYVFS Sbjct: 4 IMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 72.4 bits (176), Expect = 1e-14 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 200 VMSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 +MSPV+SE+LLSG TINST +HLVQSFSVVFLYWFYVFS Sbjct: 4 IMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 72.0 bits (175), Expect = 2e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPVLSEILLSG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 71.6 bits (174), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPVLSEILLSG T+NS+ SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 71.6 bits (174), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSP+LSEILLSG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|1002236982|ref|XP_015622691.1| PREDICTED: uncharacterized protein LOC107279891 [Oryza sativa Japonica Group] gi|1009144841|ref|XP_015890019.1| PREDICTED: uncharacterized protein LOC107424684 [Ziziphus jujuba] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] gi|992168917|gb|KXG29403.1| hypothetical protein SORBI_004G031200 [Sorghum bicolor] Length = 41 Score = 71.2 bits (173), Expect = 3e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPV+SEILLSG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261451 [Ricinus communis] Length = 41 Score = 70.9 bits (172), Expect = 4e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPV+SEILLSG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 70.5 bits (171), Expect = 6e-14 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 M+P+LSEILLSG TINST R +HLVQS SVVFLYWFYVFS Sbjct: 1 MTPILSEILLSGFTINSTLRRRTHLVQSLSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 69.7 bits (169), Expect = 1e-13 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPVLSEIL SG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 69.3 bits (168), Expect = 2e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSPVLSE+L SG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 69.3 bits (168), Expect = 2e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSP+LSEILL G INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 68.9 bits (167), Expect = 3e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 M+PVL EILLSG INST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 68.9 bits (167), Expect = 3e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 197 MSPVLSEILLSGITINSTFRHGSHLVQSFSVVFLYWFYVFS 75 MSP++SEILLSG INS+ R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41