BLASTX nr result
ID: Rehmannia28_contig00004490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00004490 (523 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 75 3e-15 ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709... 75 8e-15 ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980... 74 9e-15 ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165... 74 9e-15 ref|XP_012844994.1| PREDICTED: uncharacterized protein LOC105965... 73 1e-14 ref|XP_015958167.1| PREDICTED: uncharacterized protein LOC107482... 72 2e-14 ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 72 2e-14 ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179... 72 4e-14 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 72 4e-14 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 72 4e-14 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 72 5e-14 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 71 7e-14 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 71 1e-13 ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261... 70 1e-13 ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987... 70 2e-13 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 69 4e-13 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 69 5e-13 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 69 5e-13 ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 69 8e-13 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 69 8e-13 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] gi|723672381|ref|XP_010316390.1| PREDICTED: uncharacterized protein LOC104645744 [Solanum lycopersicum] Length = 41 Score = 74.7 bits (182), Expect = 3e-15 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 M+PV+SE+LLSG T+NST R G+HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_008792809.1| PREDICTED: uncharacterized protein LOC103709303 [Phoenix dactylifera] Length = 92 Score = 75.1 bits (183), Expect = 8e-15 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP+LSEI LSG +NSTFRH +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEIFLSGFMINSTFRHPTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009394699.1| PREDICTED: uncharacterized protein LOC103980141 [Musa acuminata subsp. malaccensis] Length = 57 Score = 73.9 bits (180), Expect = 9e-15 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP+LSEILLSG +NST RH +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGCMINSTIRHRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011083185.1| PREDICTED: uncharacterized protein LOC105165758 [Sesamum indicum] Length = 43 Score = 73.6 bits (179), Expect = 9e-15 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -3 Query: 308 VMSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 +MS VLSEILLSG TVNST R SHLVQSFSVVFLYWFYVFS Sbjct: 2 IMSAVLSEILLSGFTVNSTLRRRSHLVQSFSVVFLYWFYVFS 43 >ref|XP_012844994.1| PREDICTED: uncharacterized protein LOC105965030 [Erythranthe guttata] Length = 41 Score = 73.2 bits (178), Expect = 1e-14 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPVLSEILLSG TVNS R GSHLVQS SVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSALRLGSHLVQSLSVVFLYWFYVFS 41 >ref|XP_015958167.1| PREDICTED: uncharacterized protein LOC107482251 [Arachis duranensis] gi|1012175984|ref|XP_015966939.1| PREDICTED: uncharacterized protein LOC107490651 [Arachis duranensis] Length = 41 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPV+ EILLSG T+NST R SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVICEILLSGFTINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP+LSEILLSG +NST R SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_011100957.1| PREDICTED: uncharacterized protein LOC105179060 [Sesamum indicum] Length = 41 Score = 72.0 bits (175), Expect = 4e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPVLSEILLSG TVNS+ SHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFTVNSSLHRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 72.0 bits (175), Expect = 4e-14 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 308 VMSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 +MSPV+SE+LLSG T+NST +HLVQSFSVVFLYWFYVFS Sbjct: 4 IMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 72.0 bits (175), Expect = 4e-14 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 308 VMSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 +MSPV+SE+LLSG T+NST +HLVQSFSVVFLYWFYVFS Sbjct: 4 IMSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 71.6 bits (174), Expect = 5e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPVLSEILLSG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 71.2 bits (173), Expect = 7e-14 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP+LSEILLSG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|1002236982|ref|XP_015622691.1| PREDICTED: uncharacterized protein LOC107279891 [Oryza sativa Japonica Group] gi|1009144841|ref|XP_015890019.1| PREDICTED: uncharacterized protein LOC107424684 [Ziziphus jujuba] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] gi|992168917|gb|KXG29403.1| hypothetical protein SORBI_004G031200 [Sorghum bicolor] Length = 41 Score = 70.9 bits (172), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPV+SEILLSG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_015576248.1| PREDICTED: uncharacterized protein LOC107261451 [Ricinus communis] Length = 41 Score = 70.5 bits (171), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPV+SEILLSG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009403897.1| PREDICTED: uncharacterized protein LOC103987344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 70.1 bits (170), Expect = 2e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 M+P+LSEILLSG T+NST R +HLVQS SVVFLYWFYVFS Sbjct: 1 MTPILSEILLSGFTINSTLRRRTHLVQSLSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 69.3 bits (168), Expect = 4e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPVLSEIL SG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 68.9 bits (167), Expect = 5e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSPVLSE+L SG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 68.9 bits (167), Expect = 5e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP+LSEILL G +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 68.6 bits (166), Expect = 8e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 M+PVL EILLSG +NST R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 68.6 bits (166), Expect = 8e-13 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 305 MSPVLSEILLSGITVNSTFRHGSHLVQSFSVVFLYWFYVFS 183 MSP++SEILLSG +NS+ R +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41