BLASTX nr result
ID: Rehmannia28_contig00003255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003255 (523 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835066.1| PREDICTED: cyclin-B1-2-like [Erythranthe gut... 80 3e-16 ref|XP_011085551.1| PREDICTED: cyclin-B1-2-like [Sesamum indicum] 78 3e-15 ref|XP_011099285.1| PREDICTED: cyclin-B1-2 [Sesamum indicum] 75 4e-14 ref|XP_009784995.1| PREDICTED: cyclin-B1-2-like [Nicotiana sylve... 74 6e-14 ref|XP_009617264.1| PREDICTED: cyclin-B1-2-like [Nicotiana tomen... 74 6e-14 ref|XP_015880529.1| PREDICTED: cyclin-B1-2-like [Ziziphus jujuba] 74 8e-14 ref|XP_009771580.1| PREDICTED: cyclin-B1-2-like [Nicotiana sylve... 74 1e-13 ref|XP_010262639.1| PREDICTED: cyclin-B1-2 [Nelumbo nucifera] 73 2e-13 ref|XP_008459455.1| PREDICTED: cyclin-B1-2-like [Cucumis melo] 73 2e-13 ref|XP_004141496.1| PREDICTED: cyclin-B1-2 [Cucumis sativus] gi|... 73 2e-13 ref|XP_010032612.1| PREDICTED: cyclin-B1-2 [Eucalyptus grandis] 72 3e-13 gb|KFK41126.1| hypothetical protein AALP_AA2G089500 [Arabis alpina] 72 3e-13 ref|XP_015964682.1| PREDICTED: cyclin-B1-2-like [Arachis duranen... 72 4e-13 gb|ERN03470.1| hypothetical protein AMTR_s00003p00267670 [Ambore... 70 4e-13 ref|XP_011622756.1| PREDICTED: cyclin-B1-2 isoform X2 [Amborella... 72 5e-13 ref|XP_006842692.1| PREDICTED: cyclin-B1-2 isoform X1 [Amborella... 72 6e-13 ref|XP_015063629.1| PREDICTED: cyclin-B1-2-like [Solanum pennellii] 72 6e-13 ref|XP_010316188.1| PREDICTED: cyclin-B1-2 [Solanum lycopersicum] 72 6e-13 ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] 72 6e-13 ref|XP_010265292.1| PREDICTED: cyclin-B1-2-like [Nelumbo nucifera] 72 6e-13 >ref|XP_012835066.1| PREDICTED: cyclin-B1-2-like [Erythranthe guttata] gi|604335465|gb|EYU39374.1| hypothetical protein MIMGU_mgv1a015968mg [Erythranthe guttata] Length = 139 Score = 80.1 bits (196), Expect = 3e-16 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSES+RPIDMHHGMEVRLGLS+GPPCPSFM Sbjct: 104 YLNDPRDSESYRPIDMHHGMEVRLGLSKGPPCPSFM 139 >ref|XP_011085551.1| PREDICTED: cyclin-B1-2-like [Sesamum indicum] Length = 140 Score = 77.8 bits (190), Expect = 3e-15 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSESFRP+DMHHGMEVRLGLS+GP CPSFM Sbjct: 105 YLNDPRDSESFRPVDMHHGMEVRLGLSKGPACPSFM 140 >ref|XP_011099285.1| PREDICTED: cyclin-B1-2 [Sesamum indicum] Length = 139 Score = 74.7 bits (182), Expect = 4e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPR+SESFRP+DMHHGMEVRLGLS+GPP PSFM Sbjct: 104 YLNDPRESESFRPVDMHHGMEVRLGLSKGPPQPSFM 139 >ref|XP_009784995.1| PREDICTED: cyclin-B1-2-like [Nicotiana sylvestris] Length = 141 Score = 74.3 bits (181), Expect = 6e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP+DSESFRP DMHHGMEVRLGLSRGP CPSF+ Sbjct: 106 YLNDPKDSESFRPADMHHGMEVRLGLSRGPVCPSFI 141 >ref|XP_009617264.1| PREDICTED: cyclin-B1-2-like [Nicotiana tomentosiformis] Length = 141 Score = 74.3 bits (181), Expect = 6e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP+DSESFRP DMHHGMEVRLGLSRGP CPSF+ Sbjct: 106 YLNDPKDSESFRPADMHHGMEVRLGLSRGPVCPSFI 141 >ref|XP_015880529.1| PREDICTED: cyclin-B1-2-like [Ziziphus jujuba] Length = 126 Score = 73.6 bits (179), Expect = 8e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPR+SE FRP+DMHHGMEVRLGLS+GP CPSFM Sbjct: 91 YLNDPRESEVFRPVDMHHGMEVRLGLSKGPVCPSFM 126 >ref|XP_009771580.1| PREDICTED: cyclin-B1-2-like [Nicotiana sylvestris] Length = 141 Score = 73.6 bits (179), Expect = 1e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP+DSESFRP+D HHGMEVRLGLSRGP CPSF+ Sbjct: 106 YLNDPKDSESFRPVDTHHGMEVRLGLSRGPVCPSFI 141 >ref|XP_010262639.1| PREDICTED: cyclin-B1-2 [Nelumbo nucifera] Length = 141 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSE+FRP DMHHGMEVRLGLS+GP CPSF+ Sbjct: 106 YLNDPRDSETFRPADMHHGMEVRLGLSKGPVCPSFI 141 >ref|XP_008459455.1| PREDICTED: cyclin-B1-2-like [Cucumis melo] Length = 141 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPR+SES RP+DMHHGMEVRLGLS+GP CPSFM Sbjct: 106 YLNDPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 141 >ref|XP_004141496.1| PREDICTED: cyclin-B1-2 [Cucumis sativus] gi|700197392|gb|KGN52569.1| hypothetical protein Csa_5G643970 [Cucumis sativus] Length = 141 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPR+SES RP+DMHHGMEVRLGLS+GP CPSFM Sbjct: 106 YLNDPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 141 >ref|XP_010032612.1| PREDICTED: cyclin-B1-2 [Eucalyptus grandis] Length = 141 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 5 LNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 LNDPRDSESFRP+DMHHG EVRLGLS+GP CPSFM Sbjct: 107 LNDPRDSESFRPLDMHHGTEVRLGLSKGPACPSFM 141 >gb|KFK41126.1| hypothetical protein AALP_AA2G089500 [Arabis alpina] Length = 141 Score = 72.4 bits (176), Expect = 3e-13 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSE+F+P+D HHGMEVRLG+S+GP CPSFM Sbjct: 106 YLNDPRDSETFKPVDFHHGMEVRLGISKGPVCPSFM 141 >ref|XP_015964682.1| PREDICTED: cyclin-B1-2-like [Arachis duranensis] Length = 142 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPR+SE+ RP+DMHHGMEVRLGLS+GP CPSFM Sbjct: 107 YLNDPRESETLRPLDMHHGMEVRLGLSKGPVCPSFM 142 >gb|ERN03470.1| hypothetical protein AMTR_s00003p00267670 [Amborella trichopoda] Length = 88 Score = 70.5 bits (171), Expect = 4e-13 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSESFRP+DMH GMEVRLGL +GP CPSF+ Sbjct: 53 YLNDPRDSESFRPVDMHSGMEVRLGLDKGPICPSFI 88 >ref|XP_011622756.1| PREDICTED: cyclin-B1-2 isoform X2 [Amborella trichopoda] Length = 137 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSESFRP+DMH+GMEVRLGL++GP CPSF+ Sbjct: 102 YLNDPRDSESFRPVDMHNGMEVRLGLAKGPICPSFI 137 >ref|XP_006842692.1| PREDICTED: cyclin-B1-2 isoform X1 [Amborella trichopoda] gi|548844793|gb|ERN04367.1| hypothetical protein AMTR_s00147p00071690 [Amborella trichopoda] Length = 139 Score = 71.6 bits (174), Expect = 6e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSESFRP+DMH+GMEVRLGL++GP CPSF+ Sbjct: 104 YLNDPRDSESFRPVDMHNGMEVRLGLAKGPICPSFI 139 >ref|XP_015063629.1| PREDICTED: cyclin-B1-2-like [Solanum pennellii] Length = 141 Score = 71.6 bits (174), Expect = 6e-13 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP++SESFRP+DMHHG+EVRLGLS+GP CPSF+ Sbjct: 106 YLNDPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 141 >ref|XP_010316188.1| PREDICTED: cyclin-B1-2 [Solanum lycopersicum] Length = 141 Score = 71.6 bits (174), Expect = 6e-13 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP++SESFRP+DMHHG+EVRLGLS+GP CPSF+ Sbjct: 106 YLNDPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 141 >ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] Length = 141 Score = 71.6 bits (174), Expect = 6e-13 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDP++SESFRP+DMHHG+EVRLGLS+GP CPSF+ Sbjct: 106 YLNDPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 141 >ref|XP_010265292.1| PREDICTED: cyclin-B1-2-like [Nelumbo nucifera] Length = 142 Score = 71.6 bits (174), Expect = 6e-13 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 2 YLNDPRDSESFRPIDMHHGMEVRLGLSRGPPCPSFM 109 YLNDPRDSE FRP DMHHGME+RLGLS+GP CPSF+ Sbjct: 107 YLNDPRDSEIFRPADMHHGMEIRLGLSKGPVCPSFI 142