BLASTX nr result
ID: Rehmannia28_contig00003181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003181 (1579 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_620838.1| 12K triple gene block protein [Plantago asiatic... 64 3e-09 gb|AMN10085.1| triple gene block protein 2 [Plantago asiatica mo... 62 2e-08 gb|AMD78103.1| TGB2 [Plantago asiatica mosaic virus] 60 7e-08 emb|CEN56832.1| triple gene block protein2 [Plantago asiatica mo... 60 7e-08 gb|AGW45383.1| triple gene block protein 2 [Plantago asiatica mo... 60 7e-08 dbj|BAG12155.1| triple gene block protein2 [Plantago asiatica mo... 58 5e-07 dbj|BAG12125.1| triple gene block protein2 [Plantago asiatica mo... 58 5e-07 gb|AAX19933.1| triple gene block protein 2 [Nandina mosaic virus] 57 9e-07 >ref|NP_620838.1| 12K triple gene block protein [Plantago asiatica mosaic virus] gi|1174973|sp|Q07519.1|TGB2_P1AMV RecName: Full=Movement protein TGB2; AltName: Full=12 kDa protein; AltName: Full=Triple gene block 2 protein; Short=TGBp2 gi|299808|gb|AAB26349.1| 12 kda putative membrane-associated protein [Plantago asiatica mosaic virus] gi|311647|emb|CAA79763.1| 12K-protein [Plantago asiatica mosaic virus] Length = 110 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSPS+ K+RDP PFAFLLILTLSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPSASKTRDPFPFAFLLILTLSGLILLLSRR 95 >gb|AMN10085.1| triple gene block protein 2 [Plantago asiatica mosaic virus] Length = 110 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP++ K+RDP P+AFLLILTLSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNASKARDPFPYAFLLILTLSGLILLLSRR 95 >gb|AMD78103.1| TGB2 [Plantago asiatica mosaic virus] Length = 110 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP+ KSRDPLP AFL +LTLSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNHSKSRDPLPLAFLTVLTLSGLILLLSRR 95 >emb|CEN56832.1| triple gene block protein2 [Plantago asiatica mosaic virus] Length = 110 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP+ KSRDPLP AFL +LTLSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNHSKSRDPLPLAFLTVLTLSGLILLLSRR 95 >gb|AGW45383.1| triple gene block protein 2 [Plantago asiatica mosaic virus] Length = 110 Score = 60.5 bits (145), Expect = 7e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP+ KSRDPLP AFL +LTLSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNHSKSRDPLPLAFLTVLTLSGLILLLSRR 95 >dbj|BAG12155.1| triple gene block protein2 [Plantago asiatica mosaic virus] Length = 110 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP+ KSRDPLP AFL +L LSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNHSKSRDPLPLAFLTVLILSGLILLLSRR 95 >dbj|BAG12125.1| triple gene block protein2 [Plantago asiatica mosaic virus] gi|169219479|dbj|BAG12130.1| triple gene block protein2 [Plantago asiatica mosaic virus] gi|169219485|dbj|BAG12135.1| triple gene block protein2 [Plantago asiatica mosaic virus] gi|169219491|dbj|BAG12140.1| triple gene block protein2 [Plantago asiatica mosaic virus] gi|169219497|dbj|BAG12145.1| triple gene block protein2 [Plantago asiatica mosaic virus] gi|169219503|dbj|BAG12150.1| triple gene block protein2 [Plantago asiatica mosaic virus] Length = 110 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKKK 126 Y DGTKSI YFSP+ KSRDPLP AFL +L LSG +L+ ++ Sbjct: 54 YVDGTKSISYFSPNHSKSRDPLPLAFLTVLILSGLILLLSRR 95 >gb|AAX19933.1| triple gene block protein 2 [Nandina mosaic virus] Length = 110 Score = 57.4 bits (137), Expect = 9e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +1 Query: 1 YTDGTKSIHYFSPSSYKSRDPLPFAFLLILTLSGKVLITKK 123 Y DGTKSI YFSP+S RDP P+AFLL+ TLSG +L+ + Sbjct: 54 YVDGTKSISYFSPNSSTRRDPFPYAFLLVFTLSGLILLLSR 94