BLASTX nr result
ID: Rehmannia28_contig00003101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003101 (627 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59409.1| hypothetical protein [Plantago major] 64 2e-10 gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] 62 6e-10 gb|KVH92970.1| Translation machinery associated TMA7, partial [C... 60 1e-08 gb|KJB35051.1| hypothetical protein B456_006G098200 [Gossypium r... 58 3e-08 gb|KHG00266.1| Translation machinery-associated 7 [Gossypium arb... 57 7e-08 gb|ACS96448.1| unknown protein [Jatropha curcas] gi|300078541|gb... 57 7e-08 gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasilien... 57 7e-08 ref|NP_563969.1| translation machinery associated protein TMA7 [... 57 1e-07 ref|XP_010098057.1| hypothetical protein L484_026188 [Morus nota... 56 1e-07 ref|XP_013585904.1| PREDICTED: translation machinery-associated ... 56 1e-07 gb|KFK43783.1| hypothetical protein AALP_AA1G172000 [Arabis alpina] 56 1e-07 gb|ADK13064.1| conserved hypothetical protein 7 [Hevea brasilien... 56 1e-07 ref|XP_008438347.1| PREDICTED: translation machinery-associated ... 57 2e-07 ref|XP_003604469.1| translation machinery associated TMA7 protei... 56 2e-07 gb|KRG89763.1| hypothetical protein GLYMA_20G047300 [Glycine max] 56 2e-07 gb|KRH44363.1| hypothetical protein GLYMA_08G206000 [Glycine max] 56 2e-07 gb|KHN47814.1| Coiled-coil domain-containing protein 72 [Glycine... 56 2e-07 emb|CDO98046.1| unnamed protein product [Coffea canephora] 56 2e-07 ref|XP_006426992.1| hypothetical protein CICLE_v10026914mg [Citr... 56 2e-07 gb|ERN16646.1| hypothetical protein AMTR_s00051p00116820 [Ambore... 56 2e-07 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 63.5 bits (153), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 30 >gb|EPS74477.1| hypothetical protein M569_00288 [Genlisea aurea] Length = 64 Score = 62.4 bits (150), Expect = 6e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK+EKKEYDEIDKANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEIDKANI 30 >gb|KVH92970.1| Translation machinery associated TMA7, partial [Cynara cardunculus var. scolymus] Length = 122 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK+EKKEYDE+DKAN+ Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEMDKANL 30 >gb|KJB35051.1| hypothetical protein B456_006G098200 [Gossypium raimondii] Length = 64 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPKSEKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEHDLANI 30 >gb|KHG00266.1| Translation machinery-associated 7 [Gossypium arboreum] Length = 64 Score = 57.0 bits (136), Expect = 7e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK+EKKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKEYDEHDLANI 30 >gb|ACS96448.1| unknown protein [Jatropha curcas] gi|300078541|gb|ADJ67178.1| hypothetical protein [Jatropha curcas] gi|300078545|gb|ADJ67180.1| F9L1.21 protein [Jatropha curcas] Length = 64 Score = 57.0 bits (136), Expect = 7e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPKS+KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKSDKKEYDENDLANI 30 >gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasiliensis] Length = 64 Score = 57.0 bits (136), Expect = 7e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK+EKK+YDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKDYDETDTANI 30 >ref|NP_563969.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] gi|297849952|ref|XP_002892857.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|5103825|gb|AAD39655.1|AC007591_20 ESTs gb|AA650895, gb|AA720043 and gb|R29777 come from this gene [Arabidopsis thaliana] gi|12484215|gb|AAG54006.1|AF336925_1 unknown protein [Arabidopsis thaliana] gi|15028107|gb|AAK76677.1| unknown protein [Arabidopsis thaliana] gi|17065256|gb|AAL32782.1| Unknown protein [Arabidopsis thaliana] gi|20260078|gb|AAM13386.1| unknown protein [Arabidopsis thaliana] gi|21592316|gb|AAM64267.1| unknown [Arabidopsis thaliana] gi|297338699|gb|EFH69116.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|332191176|gb|AEE29297.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] Length = 64 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDLANI 30 >ref|XP_010098057.1| hypothetical protein L484_026188 [Morus notabilis] gi|703152222|ref|XP_010110336.1| hypothetical protein L484_000574 [Morus notabilis] gi|587885637|gb|EXB74494.1| hypothetical protein L484_026188 [Morus notabilis] gi|587939319|gb|EXC25980.1| hypothetical protein L484_000574 [Morus notabilis] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KK+YDE+D AN+ Sbjct: 1 MSSKQGGKAKPLKQPKADKKDYDEVDLANL 30 >ref|XP_013585904.1| PREDICTED: translation machinery-associated protein 7 [Brassica oleracea var. oleracea] gi|923512376|ref|XP_013749615.1| PREDICTED: translation machinery-associated protein 7-like [Brassica napus] gi|674893172|emb|CDY39627.1| BnaC05g11560D [Brassica napus] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEHDMANI 30 >gb|KFK43783.1| hypothetical protein AALP_AA1G172000 [Arabis alpina] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEHDMANI 30 >gb|ADK13064.1| conserved hypothetical protein 7 [Hevea brasiliensis] Length = 64 Score = 56.2 bits (134), Expect = 1e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQ K EKKEYDEIDK NI Sbjct: 1 MSSKQGGKAKPLKQGKVEKKEYDEIDKVNI 30 >ref|XP_008438347.1| PREDICTED: translation machinery-associated protein 7 homolog [Cucumis melo] Length = 105 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 497 EVLIMSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 ++ MSSKQGGKAKPLKQPK +KK+YDE+D ANI Sbjct: 38 DISAMSSKQGGKAKPLKQPKVDKKDYDEVDMANI 71 >ref|XP_003604469.1| translation machinery associated TMA7 protein [Medicago truncatula] gi|355505524|gb|AES86666.1| translation machinery associated TMA7 protein [Medicago truncatula] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MS+KQGGKAKPLK+PKS+KK+YDE+D ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEVDMANI 30 >gb|KRG89763.1| hypothetical protein GLYMA_20G047300 [Glycine max] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MS+KQGGKAKPLK+PKS+KK+YDE+D ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEVDMANI 30 >gb|KRH44363.1| hypothetical protein GLYMA_08G206000 [Glycine max] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MS+KQGGKAKPLK+PKS+KK+YDE+D ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEVDMANI 30 >gb|KHN47814.1| Coiled-coil domain-containing protein 72 [Glycine soja] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MS+KQGGKAKPLK+PKS+KK+YDE+D ANI Sbjct: 1 MSTKQGGKAKPLKKPKSDKKDYDEVDMANI 30 >emb|CDO98046.1| unnamed protein product [Coffea canephora] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KKEYDE DKA++ Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEEDKAHL 30 >ref|XP_006426992.1| hypothetical protein CICLE_v10026914mg [Citrus clementina] gi|557528982|gb|ESR40232.1| hypothetical protein CICLE_v10026914mg [Citrus clementina] gi|641814634|gb|KDO37916.1| hypothetical protein CISIN_1g035451mg [Citrus sinensis] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK++KKEYDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDEQDLANI 30 >gb|ERN16646.1| hypothetical protein AMTR_s00051p00116820 [Amborella trichopoda] Length = 64 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 485 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 396 MSSKQGGKAKPLKQPK+EKK+YDE D ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKDYDEDDLANI 30