BLASTX nr result
ID: Rehmannia28_contig00002768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00002768 (345 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC05126.1| histone H2B [Malus domestica] 89 3e-21 gb|AFK45369.1| unknown [Lotus japonicus] 89 5e-21 gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus g... 89 6e-21 emb|CAA64986.2| Histone H2b homologue [Allium cepa] 89 6e-21 gb|KCW44378.1| hypothetical protein EUGRSUZ_L02145 [Eucalyptus g... 89 6e-21 emb|CBI16181.3| unnamed protein product [Vitis vinifera] gi|2977... 89 6e-21 gb|KYP68165.1| putative histone H2B.1 [Cajanus cajan] gi|1012356... 89 6e-21 emb|CBI16180.3| unnamed protein product [Vitis vinifera] 89 6e-21 gb|KHL91135.1| hypothetical protein QW71_36400, partial [Paeniba... 89 7e-21 ref|XP_013626195.1| PREDICTED: histone H2B.7 [Brassica oleracea ... 89 1e-20 ref|XP_003543443.1| PREDICTED: probable histone H2B.3 [Glycine m... 89 1e-20 ref|XP_003540207.1| PREDICTED: histone H2B.3 [Glycine max] gi|73... 89 1e-20 ref|XP_011461273.1| PREDICTED: histone H2B-like [Fragaria vesca ... 89 1e-20 ref|XP_002534080.1| PREDICTED: histone H2B [Ricinus communis] gi... 89 1e-20 ref|XP_015941156.1| PREDICTED: probable histone H2B.3 [Arachis d... 89 1e-20 dbj|BAT94587.1| hypothetical protein VIGAN_08120100 [Vigna angul... 89 1e-20 ref|XP_014514508.1| PREDICTED: probable histone H2B.3 [Vigna rad... 89 1e-20 ref|XP_007144308.1| hypothetical protein PHAVU_007G145200g [Phas... 89 1e-20 gb|AFK44468.1| unknown [Lotus japonicus] 89 1e-20 ref|XP_003556299.1| PREDICTED: probable histone H2B.3 [Glycine m... 89 1e-20 >gb|AAC05126.1| histone H2B [Malus domestica] Length = 93 Score = 89.4 bits (220), Expect = 3e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 2 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 45 >gb|AFK45369.1| unknown [Lotus japonicus] Length = 109 Score = 89.4 bits (220), Expect = 5e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 18 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 61 >gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus grandis] Length = 112 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 21 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 64 >emb|CAA64986.2| Histone H2b homologue [Allium cepa] Length = 113 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 23 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 66 >gb|KCW44378.1| hypothetical protein EUGRSUZ_L02145 [Eucalyptus grandis] Length = 114 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 23 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 66 >emb|CBI16181.3| unnamed protein product [Vitis vinifera] gi|297746126|emb|CBI16182.3| unnamed protein product [Vitis vinifera] Length = 116 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 25 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 68 >gb|KYP68165.1| putative histone H2B.1 [Cajanus cajan] gi|1012356988|gb|KYP68173.1| putative histone H2B.1 [Cajanus cajan] Length = 117 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 26 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 69 >emb|CBI16180.3| unnamed protein product [Vitis vinifera] Length = 117 Score = 89.4 bits (220), Expect = 6e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 26 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 69 >gb|KHL91135.1| hypothetical protein QW71_36400, partial [Paenibacillus sp. IHB B 3415] Length = 121 Score = 89.4 bits (220), Expect = 7e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 30 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 73 >ref|XP_013626195.1| PREDICTED: histone H2B.7 [Brassica oleracea var. oleracea] gi|923506383|ref|XP_013701931.1| PREDICTED: histone H2B.7-like [Brassica napus] gi|674947363|emb|CDX86049.1| BnaC03g55640D [Brassica napus] Length = 132 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 41 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 84 >ref|XP_003543443.1| PREDICTED: probable histone H2B.3 [Glycine max] gi|734376916|gb|KHN21479.1| Putative histone H2B.1 [Glycine soja] gi|947073927|gb|KRH22818.1| hypothetical protein GLYMA_13G321600 [Glycine max] Length = 133 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 42 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 85 >ref|XP_003540207.1| PREDICTED: histone H2B.3 [Glycine max] gi|734392593|gb|KHN27700.1| Histone H2B.3 [Glycine soja] gi|947077702|gb|KRH26542.1| hypothetical protein GLYMA_12G179100 [Glycine max] Length = 134 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 43 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 86 >ref|XP_011461273.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca] Length = 135 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 44 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 87 >ref|XP_002534080.1| PREDICTED: histone H2B [Ricinus communis] gi|223525881|gb|EEF28303.1| histone h2b, putative [Ricinus communis] Length = 135 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 44 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 87 >ref|XP_015941156.1| PREDICTED: probable histone H2B.3 [Arachis duranensis] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >dbj|BAT94587.1| hypothetical protein VIGAN_08120100 [Vigna angularis var. angularis] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >ref|XP_014514508.1| PREDICTED: probable histone H2B.3 [Vigna radiata var. radiata] gi|951028762|ref|XP_014514509.1| PREDICTED: probable histone H2B.3 [Vigna radiata var. radiata] gi|920682047|gb|KOM28819.1| hypothetical protein LR48_Vigan588s002700 [Vigna angularis] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >ref|XP_007144308.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris] gi|561017498|gb|ESW16302.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >gb|AFK44468.1| unknown [Lotus japonicus] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 88 >ref|XP_003556299.1| PREDICTED: probable histone H2B.3 [Glycine max] gi|734312766|gb|KHN00944.1| Putative histone H2B.1 [Glycine soja] gi|947042382|gb|KRG92106.1| hypothetical protein GLYMA_20G191600 [Glycine max] Length = 136 Score = 89.4 bits (220), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 212 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 343 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE Sbjct: 46 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE 89