BLASTX nr result
ID: Rehmannia28_contig00002695
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00002695 (793 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane d... 76 1e-14 ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 74 9e-14 gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] 71 8e-13 ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 70 2e-12 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 70 2e-12 ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane d... 70 2e-12 ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane d... 69 5e-12 gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium r... 68 9e-12 emb|CBI30080.3| unnamed protein product [Vitis vinifera] 67 2e-11 gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] 67 2e-11 ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] ... 67 3e-11 ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arab... 67 3e-11 ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Mal... 67 3e-11 ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutr... 66 5e-11 ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutr... 66 5e-11 ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane d... 66 6e-11 ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Popu... 67 6e-11 ref|XP_013612366.1| PREDICTED: cysteine-rich and transmembrane d... 66 8e-11 emb|CDX70261.1| BnaA10g26100D [Brassica napus] 66 8e-11 ref|XP_013668202.1| PREDICTED: cysteine-rich and transmembrane d... 66 8e-11 >ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Solanum tuberosum] Length = 62 Score = 75.9 bits (185), Expect = 1e-14 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCFD 293 KK KG PR+K +G+RGFLEGCLFALCCCWLCEVCFD Sbjct: 27 KKMKGWPRSKPRGERGFLEGCLFALCCCWLCEVCFD 62 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 73.6 bits (179), Expect = 9e-14 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCFD 293 KK K PR+K KG+RGFLEGCLFALCCCW+CEVCFD Sbjct: 27 KKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCFD 62 >gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 70.9 bits (172), Expect = 8e-13 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 KKK P TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 23 KKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 70.1 bits (170), Expect = 2e-12 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 KKK L +TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 27 KKKCLSQTKKKGDRGFIEGCLFALCCCWLCEACF 60 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 70.1 bits (170), Expect = 2e-12 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 KK K P++K KG+RGFLEGCLFALCCCW+CEVCF Sbjct: 27 KKMKCFPKSKPKGERGFLEGCLFALCCCWICEVCF 61 >ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Pyrus x bretschneideri] Length = 61 Score = 70.1 bits (170), Expect = 2e-12 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 394 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 KK PRTKAKG+RGF+EGCLFALCCCWLCE CF Sbjct: 29 KKFRPRTKAKGERGFIEGCLFALCCCWLCEECF 61 >ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Fragaria vesca subsp. vesca] Length = 59 Score = 68.9 bits (167), Expect = 5e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 +KK P+TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 26 RKKFRPQTKKKGDRGFIEGCLFALCCCWLCEECF 59 >gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 68.2 bits (165), Expect = 9e-12 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 + K PR+K KGDRGF+EGCLFALCCCWLCE CF Sbjct: 27 QNKCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 60 >emb|CBI30080.3| unnamed protein product [Vitis vinifera] Length = 56 Score = 67.4 bits (163), Expect = 2e-11 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 394 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 K PR+K+KGDRGF+EGCLFALCCCW+CE CF Sbjct: 24 KNCCPRSKSKGDRGFIEGCLFALCCCWICEACF 56 >gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] Length = 67 Score = 67.4 bits (163), Expect = 2e-11 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = -1 Query: 400 KKKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 296 +KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 30 EKKKKKPRFFETKEKGDRGFIEGCLFALCCCWICEMCF 67 >ref|NP_196028.2| uncharacterized protein [Arabidopsis thaliana] gi|38603900|gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gi|41349906|gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gi|332003311|gb|AED90694.1| uncharacterized protein AT5G04080 [Arabidopsis thaliana] Length = 63 Score = 67.0 bits (162), Expect = 3e-11 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 397 KKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 296 KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 27 KKKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|XP_002871075.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] gi|297316912|gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 67.0 bits (162), Expect = 3e-11 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 397 KKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 296 KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64 >ref|XP_008359585.1| PREDICTED: CYSTM1 family protein A-like [Malus domestica] Length = 58 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 394 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 KK P TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 26 KKFRPWTKKKGDRGFIEGCLFALCCCWLCEECF 58 >ref|XP_006398865.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099955|gb|ESQ40318.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 59 Score = 66.2 bits (160), Expect = 5e-11 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 +KK + +TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 26 EKKKVFKTKQKGDRGFIEGCLFALCCCWVCEMCF 59 >ref|XP_006398866.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] gi|557099956|gb|ESQ40319.1| hypothetical protein EUTSA_v10015225mg [Eutrema salsugineum] Length = 64 Score = 66.2 bits (160), Expect = 5e-11 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 397 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 +KK + +TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 31 EKKKVFKTKQKGDRGFIEGCLFALCCCWVCEMCF 64 >ref|XP_010543520.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Tarenaya hassleriana] Length = 65 Score = 66.2 bits (160), Expect = 6e-11 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = -1 Query: 400 KKKKGLPR--TKAKGDRGFLEGCLFALCCCWLCEVC 299 KKKK LP TK KGDRGF+EGCLFALCCCW+CE+C Sbjct: 29 KKKKLLPSFGTKQKGDRGFIEGCLFALCCCWICEMC 64 >ref|XP_002308904.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] gi|550335432|gb|EEE92427.2| hypothetical protein POPTR_0006s04180g [Populus trichocarpa] Length = 94 Score = 67.0 bits (162), Expect = 6e-11 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 394 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVC 299 KK PRTK KG+RGF+EGCLFALCCCW+CE+C Sbjct: 62 KKCFPRTKKKGERGFIEGCLFALCCCWICEMC 93 >ref|XP_013612366.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Brassica oleracea var. oleracea] Length = 65 Score = 65.9 bits (159), Expect = 8e-11 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 K KK TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 31 KNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65 >emb|CDX70261.1| BnaA10g26100D [Brassica napus] Length = 65 Score = 65.9 bits (159), Expect = 8e-11 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 K KK TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 31 KNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65 >ref|XP_013668202.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Brassica napus] gi|674891345|emb|CDY41401.1| BnaCnng10370D [Brassica napus] Length = 65 Score = 65.9 bits (159), Expect = 8e-11 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 400 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 296 K KK TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 31 KNKKKPFETKQKGDRGFIEGCLFALCCCWICEMCF 65