BLASTX nr result
ID: Rehmannia28_contig00002655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00002655 (437 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846075.1| PREDICTED: methionine aminopeptidase 1B, chl... 74 7e-13 ref|XP_011070833.1| PREDICTED: methionine aminopeptidase 1B, chl... 62 1e-08 >ref|XP_012846075.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic [Erythranthe guttata] gi|604318451|gb|EYU29943.1| hypothetical protein MIMGU_mgv1a008750mg [Erythranthe guttata] gi|604318452|gb|EYU29944.1| hypothetical protein MIMGU_mgv1a008750mg [Erythranthe guttata] Length = 363 Score = 73.9 bits (180), Expect = 7e-13 Identities = 41/75 (54%), Positives = 47/75 (62%) Frame = +1 Query: 211 VHGEARLSASSTLLMGTSLASPIPSPLYNLKGTSRLSVHAKKISGXXXXXXXXXXXXXXT 390 VHGE +LSASSTLLMG LAS P P Y+LK L + +K++SG T Sbjct: 16 VHGETKLSASSTLLMGAPLASRSPCPPYDLKMARPLVIQSKRLSGLEESIRIRRERELQT 75 Query: 391 SPTSKRRPALRRGKV 435 S TSKRRPALRRGKV Sbjct: 76 STTSKRRPALRRGKV 90 >ref|XP_011070833.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic [Sesamum indicum] Length = 371 Score = 62.0 bits (149), Expect = 1e-08 Identities = 40/75 (53%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = +1 Query: 214 HGEARLSASSTLLMGTSLASPIPSPLYNLKGTSRLS-VHAKKISGXXXXXXXXXXXXXXT 390 HGE LSASSTLLMG+ L S S + K T RL VH+K+ISG T Sbjct: 24 HGEGILSASSTLLMGSPLGSRNSSSPSSPKVTKRLLLVHSKRISGLEEAIRIRRERELRT 83 Query: 391 SPTSKRRPALRRGKV 435 SPTSKR P LRRGKV Sbjct: 84 SPTSKRMPPLRRGKV 98