BLASTX nr result
ID: Rehmannia28_contig00001419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00001419 (356 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100713.1| PREDICTED: 30S ribosomal protein S1, chlorop... 67 1e-10 >ref|XP_011100713.1| PREDICTED: 30S ribosomal protein S1, chloroplastic-like isoform X1 [Sesamum indicum] Length = 428 Score = 67.0 bits (162), Expect = 1e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 241 LIRRLSRVLVHLYQKSTAEELLEKEIPLKFVEVDEEQS 354 LIRRLSR LV+L+QKSTAEELLEKE+PLKFVEVDEEQS Sbjct: 222 LIRRLSRGLVNLFQKSTAEELLEKELPLKFVEVDEEQS 259