BLASTX nr result
ID: Rehmannia28_contig00001386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00001386 (794 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089057.1| PREDICTED: uncharacterized histidine-rich pr... 58 1e-12 >ref|XP_011089057.1| PREDICTED: uncharacterized histidine-rich protein DDB_G0274557-like [Sesamum indicum] Length = 145 Score = 57.8 bits (138), Expect(2) = 1e-12 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = -1 Query: 689 YVSPNCPLHRSILQPNNHXXXXXXXXXXXXPQNPQPLASIPPDPHFSFV 543 Y+SP+CP HRS+ QP NH PQNP+P+ASIPP+ H SF+ Sbjct: 37 YISPHCPFHRSMSQPKNHSPSCSFSTYYPSPQNPEPVASIPPNSHSSFL 85 Score = 43.1 bits (100), Expect(2) = 1e-12 Identities = 17/21 (80%), Positives = 21/21 (100%) Frame = -2 Query: 526 EEEEPIFVLTDEWREFFAKSE 464 EE++PI+VLTDEWR+FFAKSE Sbjct: 110 EEDDPIYVLTDEWRDFFAKSE 130