BLASTX nr result
ID: Rehmannia28_contig00001338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00001338 (341 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835078.1| PREDICTED: thioredoxin-like protein HCF164, ... 89 4e-19 ref|XP_011085523.1| PREDICTED: thioredoxin-like protein HCF164, ... 84 1e-17 ref|XP_011085522.1| PREDICTED: thioredoxin-like protein HCF164, ... 84 2e-17 >ref|XP_012835078.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic [Erythranthe guttata] gi|604335478|gb|EYU39387.1| hypothetical protein MIMGU_mgv1a011778mg [Erythranthe guttata] Length = 271 Score = 88.6 bits (218), Expect = 4e-19 Identities = 46/67 (68%), Positives = 50/67 (74%), Gaps = 1/67 (1%) Frame = +3 Query: 141 MARVASTSSAVGLPRFRPSSFQSHHQTPRFVNFSFHFQKKNHGLHRIICRNNPNPVDS-A 317 MAR ASTSS +GLPRF PSS QS HQ P FVNFS QKK RI C+NNP+PVDS A Sbjct: 1 MARAASTSSTIGLPRFSPSSLQSPHQPPSFVNFSSCVQKKTRRHRRIFCQNNPDPVDSAA 60 Query: 318 AAEEKPL 338 AA+EKPL Sbjct: 61 AADEKPL 67 >ref|XP_011085523.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic isoform X2 [Sesamum indicum] Length = 268 Score = 84.3 bits (207), Expect = 1e-17 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = +3 Query: 141 MARVASTSSAVGLPRFRPSSFQSHHQTPRFVNFSFHFQKKNHGLHRIICRNNPNPVDSAA 320 MAR+ STS+AVGL FRPSS Q + Q PR VNFS+ FQ K+HG HRI C+ NP+ VDSAA Sbjct: 1 MARLVSTSTAVGLSTFRPSSLQYNQQQPRLVNFSY-FQNKHHGHHRIFCQTNPDSVDSAA 59 Query: 321 AEEK 332 EEK Sbjct: 60 TEEK 63 >ref|XP_011085522.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic isoform X1 [Sesamum indicum] Length = 284 Score = 84.3 bits (207), Expect = 2e-17 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = +3 Query: 141 MARVASTSSAVGLPRFRPSSFQSHHQTPRFVNFSFHFQKKNHGLHRIICRNNPNPVDSAA 320 MAR+ STS+AVGL FRPSS Q + Q PR VNFS+ FQ K+HG HRI C+ NP+ VDSAA Sbjct: 1 MARLVSTSTAVGLSTFRPSSLQYNQQQPRLVNFSY-FQNKHHGHHRIFCQTNPDSVDSAA 59 Query: 321 AEEK 332 EEK Sbjct: 60 TEEK 63