BLASTX nr result
ID: Rehmannia27_contig00058912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058912 (450 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095208.1| PREDICTED: transcriptional regulator TAC1 [S... 55 1e-06 >ref|XP_011095208.1| PREDICTED: transcriptional regulator TAC1 [Sesamum indicum] Length = 174 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 1 GHMNIHRKDRAKLKEFSHENLLSLGIIAKNMDSDRDSTNYPANNSSASE 147 GHMNIHRKDRAKLKEFS ENLLSL I DS+ + P +SS+S+ Sbjct: 45 GHMNIHRKDRAKLKEFSCENLLSLDITKNTTDSE----DSPPPDSSSSD 89