BLASTX nr result
ID: Rehmannia27_contig00058857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058857 (397 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_956760.2| hypothetical protein NCU01483 [Neurospora crass... 65 7e-12 emb|CCC07243.1| unnamed protein product [Sordaria macrospora k-h... 64 9e-12 gb|ELQ37118.1| hypothetical protein OOU_Y34scaffold00618g8 [Magn... 57 5e-09 ref|XP_003657991.1| hypothetical protein THITE_49533 [Thielavia ... 58 7e-09 ref|XP_003667169.1| hypothetical protein MYCTH_56363 [Myceliopht... 52 1e-06 ref|XP_001909509.1| hypothetical protein [Podospora anserina S m... 51 1e-06 gb|KOS43361.1| hypothetical protein ACN38_g5741 [Penicillium nor... 51 6e-06 ref|XP_003715381.1| hypothetical protein MGG_07177 [Magnaporthe ... 50 6e-06 >ref|XP_956760.2| hypothetical protein NCU01483 [Neurospora crassa OR74A] gi|157069740|gb|EAA27524.2| hypothetical protein NCU01483 [Neurospora crassa OR74A] Length = 29 Score = 64.7 bits (156), Expect = 7e-12 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCPN 208 MHG++CPKCGA+SDG+SKSCGSCGASCPN Sbjct: 1 MHGSSCPKCGAASDGSSKSCGSCGASCPN 29 >emb|CCC07243.1| unnamed protein product [Sordaria macrospora k-hell] Length = 29 Score = 64.3 bits (155), Expect = 9e-12 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCPN 208 MHG+ CPKCGA+SDG+SKSCGSCGASCPN Sbjct: 1 MHGSTCPKCGAASDGSSKSCGSCGASCPN 29 >gb|ELQ37118.1| hypothetical protein OOU_Y34scaffold00618g8 [Magnaporthe oryzae Y34] gi|440483536|gb|ELQ63919.1| hypothetical protein OOW_P131scaffold00922g43 [Magnaporthe oryzae P131] Length = 29 Score = 57.4 bits (137), Expect = 5e-09 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCP 211 MH CPKCGA+SDG+SK+CGSCGASCP Sbjct: 1 MHDKTCPKCGAASDGSSKTCGSCGASCP 28 >ref|XP_003657991.1| hypothetical protein THITE_49533 [Thielavia terrestris NRRL 8126] gi|347005257|gb|AEO71655.1| hypothetical protein THITE_49533 [Thielavia terrestris NRRL 8126] Length = 65 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGA-SCPN*VSRCYGTH 181 MHGT+CPKCGA+SDG SK+CGSCGA S P V R Y H Sbjct: 1 MHGTSCPKCGAASDGVSKTCGSCGAVSSPCRVHRTYLPH 39 >ref|XP_003667169.1| hypothetical protein MYCTH_56363 [Myceliophthora thermophila ATCC 42464] gi|347014442|gb|AEO61924.1| hypothetical protein MYCTH_56363 [Myceliophthora thermophila ATCC 42464] Length = 59 Score = 52.0 bits (123), Expect = 1e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCP 211 MHG+ CPKCGA+SDG SKSC SCGA P Sbjct: 1 MHGSNCPKCGAASDGASKSCDSCGAVSP 28 >ref|XP_001909509.1| hypothetical protein [Podospora anserina S mat+] gi|170944531|emb|CAP70642.1| unnamed protein product [Podospora anserina S mat+] gi|681097187|emb|CDP27231.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 27 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCPN 208 MH +CPKCGA+S+G KSCGSCGA+CPN Sbjct: 1 MHDGSCPKCGAASEG--KSCGSCGATCPN 27 >gb|KOS43361.1| hypothetical protein ACN38_g5741 [Penicillium nordicum] Length = 89 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -2 Query: 327 QEKLPKQKEDNMHG-TACPKCGASSDGTSKSCGSCGASCP 211 Q K+ M+G ACPKCGA++DG KSCG+CGA+CP Sbjct: 49 QNKIYFILSSTMNGHAACPKCGAAADGAGKSCGACGATCP 88 >ref|XP_003715381.1| hypothetical protein MGG_07177 [Magnaporthe oryzae 70-15] gi|351647714|gb|EHA55574.1| hypothetical protein MGG_07177 [Magnaporthe oryzae 70-15] Length = 78 Score = 50.4 bits (119), Expect = 6e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = -2 Query: 294 MHGTACPKCGASSDGTSKSCGSCGASCPN*VSRCYGTHRRN 172 MH CPKCGA+SDG+SK+CGSCGA +HRRN Sbjct: 1 MHDKTCPKCGAASDGSSKTCGSCGAV----------SHRRN 31