BLASTX nr result
ID: Rehmannia27_contig00058773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058773 (472 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB33199.1| hypothetical protein Lcho_0927 [Leptothrix cholod... 54 6e-07 ref|WP_043703857.1| hypothetical protein [Leptothrix cholodnii] 54 6e-07 >gb|ACB33199.1| hypothetical protein Lcho_0927 [Leptothrix cholodnii SP-6] Length = 84 Score = 53.9 bits (128), Expect = 6e-07 Identities = 31/61 (50%), Positives = 37/61 (60%) Frame = +3 Query: 84 SGAFLQLMSGLFGSRPAARPVGSSERLRVREANEVRELARSVEMQSPGFAADLYAAALRH 263 + AFL+L+ SR + S R EA VRE+ARS+E PGFAADLYAAA RH Sbjct: 24 AAAFLRLIDAFDFSRKSGAVQRDS---RAEEAESVREMARSIEASDPGFAADLYAAANRH 80 Query: 264 E 266 E Sbjct: 81 E 81 >ref|WP_043703857.1| hypothetical protein [Leptothrix cholodnii] Length = 85 Score = 53.9 bits (128), Expect = 6e-07 Identities = 31/61 (50%), Positives = 37/61 (60%) Frame = +3 Query: 84 SGAFLQLMSGLFGSRPAARPVGSSERLRVREANEVRELARSVEMQSPGFAADLYAAALRH 263 + AFL+L+ SR + S R EA VRE+ARS+E PGFAADLYAAA RH Sbjct: 25 AAAFLRLIDAFDFSRKSGAVQRDS---RAEEAESVREMARSIEASDPGFAADLYAAANRH 81 Query: 264 E 266 E Sbjct: 82 E 82