BLASTX nr result
ID: Rehmannia27_contig00058642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058642 (481 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM34111.1| hypothetical protein LR48_Vigan02g026100 [Vigna a... 53 2e-06 gb|KYP51926.1| hypothetical protein KK1_026283, partial [Cajanus... 51 8e-06 >gb|KOM34111.1| hypothetical protein LR48_Vigan02g026100 [Vigna angularis] Length = 84 Score = 52.8 bits (125), Expect = 2e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = -3 Query: 212 RKLLFSSSTDSKMMINEANKKQAKKAVEQSLRRRPPSVPNPTHN 81 RKLLFSSS + +E+NK Q KKAVE SLR+ P SVPNPT N Sbjct: 42 RKLLFSSSDSA--FTSESNKTQTKKAVEPSLRKAPSSVPNPTQN 83 >gb|KYP51926.1| hypothetical protein KK1_026283, partial [Cajanus cajan] Length = 92 Score = 51.2 bits (121), Expect = 8e-06 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = -3 Query: 215 PRKLLFSSSTDSKMMINE--ANKKQAKKAVEQSLRRRPPSVPNPTHN 81 PRKLL SS I++ NK Q KKAVE SLR+ PPSVPNPT N Sbjct: 45 PRKLLSSSFDSVSTSISKLSGNKNQPKKAVEPSLRKAPPSVPNPTQN 91