BLASTX nr result
ID: Rehmannia27_contig00058466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058466 (401 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004340174.1| universal stress domain containing protein [... 61 8e-09 gb|EFA75543.1| hypothetical protein PPL_11048 [Polysphondylium p... 53 4e-06 >ref|XP_004340174.1| universal stress domain containing protein [Acanthamoeba castellanii str. Neff] gi|440797059|gb|ELR18154.1| universal stress domain containing protein [Acanthamoeba castellanii str. Neff] Length = 231 Score = 61.2 bits (147), Expect = 8e-09 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 1/79 (1%) Frame = +1 Query: 19 EEHAVAKSQRKRSRK-VLAFYKKEAEKPGICCTLILGQYRHIGEVLCIIADRIKANHLVL 195 E H ++ +R++K ++ +++ AE+ GI T I+ + H G++LC + D + LV+ Sbjct: 56 EAHEALTARVERAQKAIMEPFRELAEERGIKSTCIMLKGHHAGQMLCTLVDERNVDFLVV 115 Query: 196 GRRSMNDIKRLLVGSTSRY 252 GRR MN +KRLL GSTS+Y Sbjct: 116 GRRGMNKVKRLLAGSTSKY 134 >gb|EFA75543.1| hypothetical protein PPL_11048 [Polysphondylium pallidum PN500] Length = 184 Score = 53.1 bits (126), Expect = 4e-06 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +1 Query: 40 SQRKRSRKVLAFYKKEAEKPGIC-CTLILGQYRHIGEVLCIIADRIKANHLVLGRRSMND 216 S K S+ +L K A+ GI +LG H+GE +C A K ++LV+GRR M Sbjct: 66 SIEKESKSILIEKAKIAKHLGIQNLRALLGHGNHVGEAVCKAALEKKIDYLVVGRRGMGP 125 Query: 217 IKRLLVGSTSRY 252 +KR+ +GSTSRY Sbjct: 126 VKRIFIGSTSRY 137