BLASTX nr result
ID: Rehmannia27_contig00058326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058326 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004072505.1| Ycf2 protein [Corynocarpus laevigata] gi|317... 62 2e-08 gb|ABQ14849.1| Ycf2 [Itea virginica] 60 8e-08 gb|ABD16778.1| probable ATPase, partial (chloroplast) [Chamerion... 59 1e-07 gb|ABD16775.1| probable ATPase, partial (chloroplast) [Clarkia b... 59 1e-07 ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lat... 59 1e-07 gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Barts... 59 1e-07 gb|ALI91610.1| Ycf2, partial (chloroplast) [Hosiea japonica] 59 1e-07 ref|YP_009191983.1| hypothetical protein RF2 (chloroplast) [Pana... 58 3e-07 ref|YP_009191896.1| hypothetical protein RF2 (chloroplast) [Pana... 58 3e-07 ref|YP_087009.1| Ycf2 [Panax ginseng] gi|52220874|ref|YP_087028.... 58 3e-07 ref|YP_009155471.1| Ycf2 (chloroplast) [Panax quinquefolius] gi|... 58 3e-07 gb|AKU70820.1| hypothetical chloroplast RF21 (chloroplast) [Pana... 58 3e-07 ref|YP_009121217.1| hypothetical chloroplast RF21 (chloroplast) ... 58 3e-07 gb|ABQ14840.1| Ycf2 [Heuchera micrantha] 58 3e-07 gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sang... 58 3e-07 gb|ALB78334.1| hypothetical chloroplast RF2 (chloroplast) [Heuch... 58 3e-07 gb|ABQ14926.1| Ycf2 [Ribes americanum] 58 3e-07 ref|XP_002863309.1| hypothetical protein ARALYDRAFT_333077 [Arab... 58 3e-07 gb|ALI91636.1| Ycf2, partial (chloroplast) [Pyrenacantha rakotaz... 58 4e-07 ref|YP_008577961.1| Ycf2 (chloroplast) [Angophora floribunda] gi... 58 4e-07 >ref|YP_004072505.1| Ycf2 protein [Corynocarpus laevigata] gi|317046232|ref|YP_004072521.1| Ycf2 protein [Corynocarpus laevigata] gi|309252933|gb|ADO60353.1| Ycf2 protein (chloroplast) [Corynocarpus laevigata] gi|309252949|gb|ADO60369.1| Ycf2 protein (chloroplast) [Corynocarpus laevigata] Length = 2316 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 PD KN ITSYGL+ENDSDLVHGL V V+GAL+ SSRTEK Sbjct: 2000 PDEKNGITSYGLVENDSDLVHGLLEVLEVEGALVGSSRTEK 2040 >gb|ABQ14849.1| Ycf2 [Itea virginica] Length = 2306 Score = 59.7 bits (143), Expect = 8e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL ++ V+GAL+ SSRTEK Sbjct: 1991 RPDEKNGITSYGLVENDSDLVHGLLELE-VEGALVGSSRTEK 2031 >gb|ABD16778.1| probable ATPase, partial (chloroplast) [Chamerion angustifolium] Length = 451 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 4/45 (8%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLS----GVKGVKGALLRSSRTEK 125 PD KNRITSYGL+ENDSDLVHGLS G+ ++GAL+ SS TEK Sbjct: 6 PDEKNRITSYGLVENDSDLVHGLSDLVHGLLELEGALVGSSPTEK 50 >gb|ABD16775.1| probable ATPase, partial (chloroplast) [Clarkia bottae] Length = 452 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 4/45 (8%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLS----GVKGVKGALLRSSRTEK 125 PD KNRITSYGL+ENDSDLVHGLS G+ ++GAL+ SS TEK Sbjct: 9 PDEKNRITSYGLVENDSDLVHGLSDLVHGLLELEGALVGSSPTEK 53 >ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|927372320|ref|YP_009164611.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590319|gb|AJD76835.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590327|gb|AJD76843.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] Length = 2261 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 PD KN ITSYGL+ENDSDLVHGL V+GAL+RSSRTEK Sbjct: 1952 PDEKNGITSYGLVENDSDLVHGL---LEVEGALVRSSRTEK 1989 >gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] gi|576598331|gb|AHH30493.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] Length = 2269 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 PD KN ITSYGL+ENDSDLVHGL V+GAL+RSSRTEK Sbjct: 1959 PDEKNGITSYGLVENDSDLVHGL---LEVEGALVRSSRTEK 1996 >gb|ALI91610.1| Ycf2, partial (chloroplast) [Hosiea japonica] Length = 2305 Score = 58.9 bits (141), Expect = 1e-07 Identities = 38/77 (49%), Positives = 48/77 (62%) Frame = -3 Query: 355 YYFTVFPFMRSLVSVLL*R*KQSIEKIKTKNPQKSRPDGKNRITSYGLIENDSDLVHGLS 176 +YF + P M+ L ++LL S + PD +NRITSYGL+ENDSDLVHGL Sbjct: 1945 WYFELGPSMKKL-TILLYLLSCSAGSVAQDLWSLPGPDEQNRITSYGLVENDSDLVHGL- 2002 Query: 175 GVKGVKGALLRSSRTEK 125 V+GAL+ SSRTEK Sbjct: 2003 --LEVEGALVGSSRTEK 2017 >ref|YP_009191983.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] gi|966201819|ref|YP_009192003.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] gi|806639879|gb|AKB99289.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] gi|806639899|gb|AKB99309.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] gi|806639967|gb|AKB99376.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] gi|806639987|gb|AKB99396.1| hypothetical protein RF2 (chloroplast) [Panax vietnamensis] Length = 2104 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1776 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1814 >ref|YP_009191896.1| hypothetical protein RF2 (chloroplast) [Panax japonicus] gi|966201731|ref|YP_009191916.1| hypothetical protein RF2 (chloroplast) [Panax japonicus] gi|806639791|gb|AKB99202.1| hypothetical protein RF2 (chloroplast) [Panax japonicus] gi|806639811|gb|AKB99222.1| hypothetical protein RF2 (chloroplast) [Panax japonicus] Length = 2110 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1782 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1820 >ref|YP_087009.1| Ycf2 [Panax ginseng] gi|52220874|ref|YP_087028.1| Ycf2 [Panax ginseng] gi|68053092|sp|Q68RU4.1|YCF2_PANGI RecName: Full=Protein Ycf2 gi|51235356|gb|AAT98552.1| ycf2 protein (chloroplast) [Panax ginseng] gi|51235377|gb|AAT98573.1| ycf2 protein (chloroplast) [Panax ginseng] gi|506444472|gb|AGM15034.1| Ycf2 (chloroplast) [Panax ginseng] gi|506444473|gb|AGM15035.1| Ycf2 (chloroplast) [Panax ginseng] gi|506444560|gb|AGM15120.1| Ycf2 (chloroplast) [Panax ginseng] gi|506444561|gb|AGM15121.1| Ycf2 (chloroplast) [Panax ginseng] gi|506444676|gb|AGM15206.1| Ycf2 (chloroplast) [Panax ginseng] gi|506444677|gb|AGM15207.1| Ycf2 (chloroplast) [Panax ginseng] gi|545484774|gb|AGW31966.1| Ycf2 (chloroplast) [Panax ginseng] gi|545484775|gb|AGW31967.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604145|gb|AIX97932.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604163|gb|AIX97950.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604232|gb|AIX98018.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604249|gb|AIX98035.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604317|gb|AIX98102.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604335|gb|AIX98120.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604403|gb|AIX98187.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604421|gb|AIX98205.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604489|gb|AIX98272.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604507|gb|AIX98290.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604575|gb|AIX98357.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604593|gb|AIX98375.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604661|gb|AIX98442.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604679|gb|AIX98460.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604747|gb|AIX98527.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604765|gb|AIX98545.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604833|gb|AIX98612.1| Ycf2 (chloroplast) [Panax ginseng] gi|723604853|gb|AIX98632.1| Ycf2 (chloroplast) [Panax ginseng] gi|744671850|gb|AJC99616.1| Ycf2 (chloroplast) [Panax ginseng] gi|744671868|gb|AJC99634.1| Ycf2 (chloroplast) [Panax ginseng] gi|744671958|gb|AJC99701.1| Ycf2 (chloroplast) [Panax ginseng] gi|744671976|gb|AJC99719.1| Ycf2 (chloroplast) [Panax ginseng] Length = 2110 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1782 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1820 >ref|YP_009155471.1| Ycf2 (chloroplast) [Panax quinquefolius] gi|884997706|ref|YP_009155489.1| Ycf2 (chloroplast) [Panax quinquefolius] gi|744671739|gb|AJC99531.1| Ycf2 (chloroplast) [Panax quinquefolius] gi|744671757|gb|AJC99549.1| Ycf2 (chloroplast) [Panax quinquefolius] gi|917544209|gb|AKZ29791.1| hypothetical chloroplast RF21 (chloroplast) [Panax quinquefolius] gi|917544228|gb|AKZ29810.1| hypothetical chloroplast RF21 (chloroplast) [Panax quinquefolius] Length = 2110 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1782 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1820 >gb|AKU70820.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|913021677|gb|AKU70840.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] Length = 2115 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1787 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1825 >ref|YP_009121217.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|761380051|ref|YP_009121236.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|638920776|gb|AIA24371.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|638920795|gb|AIA24390.1| hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] gi|806639703|gb|AKB99115.1| hypothetical protein RF2 (chloroplast) [Panax notoginseng] gi|806639723|gb|AKB99135.1| hypothetical protein RF2 (chloroplast) [Panax notoginseng] gi|818214085|gb|AKG26644.1| Ycf2 (chloroplast) [Panax notoginseng] gi|818214103|gb|AKG26662.1| Ycf2 (chloroplast) [Panax notoginseng] Length = 2121 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1793 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 1831 >gb|ABQ14840.1| Ycf2 [Heuchera micrantha] Length = 2290 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1980 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 2018 >gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sanguinea] gi|340807140|gb|AEK71737.1| hypothetical chloroplast RF2 [Heuchera sanguinea] Length = 2290 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1980 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 2018 >gb|ALB78334.1| hypothetical chloroplast RF2 (chloroplast) [Heuchera parviflora var. saurensis] gi|924443805|gb|ALB78335.1| hypothetical chloroplast RF2 (chloroplast) [Heuchera parviflora var. saurensis] Length = 2292 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1982 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 2020 >gb|ABQ14926.1| Ycf2 [Ribes americanum] Length = 2301 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 250 RPDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 RPD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1984 RPDEKNGITSYGLVENDSDLVHGL---LEVEGALVGSSRTEK 2022 >ref|XP_002863309.1| hypothetical protein ARALYDRAFT_333077 [Arabidopsis lyrata subsp. lyrata] gi|297309143|gb|EFH39568.1| hypothetical protein ARALYDRAFT_333077 [Arabidopsis lyrata subsp. lyrata] Length = 649 Score = 57.8 bits (138), Expect = 3e-07 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 PD KNRITSYG IENDSDLVHGL V+GAL+ SSRTEK Sbjct: 350 PDEKNRITSYGFIENDSDLVHGL---LEVQGALVGSSRTEK 387 >gb|ALI91636.1| Ycf2, partial (chloroplast) [Pyrenacantha rakotazafyi] Length = 2263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 38/77 (49%), Positives = 47/77 (61%) Frame = -3 Query: 355 YYFTVFPFMRSLVSVLL*R*KQSIEKIKTKNPQKSRPDGKNRITSYGLIENDSDLVHGLS 176 +YF + P M+ L ++LL S + PD +N ITSYGL+ENDSDLVHGL Sbjct: 1903 WYFELGPSMKKL-TILLYLLSCSAGSVAQDLWSLPGPDEQNGITSYGLVENDSDLVHGL- 1960 Query: 175 GVKGVKGALLRSSRTEK 125 VKGAL+ SSRTEK Sbjct: 1961 --LEVKGALVGSSRTEK 1975 >ref|YP_008577961.1| Ycf2 (chloroplast) [Angophora floribunda] gi|545719145|ref|YP_008577980.1| Ycf2 (chloroplast) [Angophora floribunda] gi|545719212|ref|YP_008578046.1| Ycf2 (chloroplast) [Angophora costata] gi|545719231|ref|YP_008578065.1| Ycf2 (chloroplast) [Angophora costata] gi|442569206|gb|AGC59370.1| Ycf2 (chloroplast) [Angophora floribunda] gi|442569225|gb|AGC59389.1| Ycf2 (chloroplast) [Angophora floribunda] gi|442569292|gb|AGC59455.1| Ycf2 (chloroplast) [Angophora costata] gi|442569311|gb|AGC59474.1| Ycf2 (chloroplast) [Angophora costata] Length = 2280 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 247 PDGKNRITSYGLIENDSDLVHGLSGVKGVKGALLRSSRTEK 125 PD KN ITSYGL+ENDSDLVHGL V+GAL+ SSRTEK Sbjct: 1969 PDEKNEITSYGLVENDSDLVHGL---LEVEGALVESSRTEK 2006