BLASTX nr result
ID: Rehmannia27_contig00058321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00058321 (382 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844836.1| PREDICTED: putative late blight resistance p... 97 6e-21 gb|EYU31552.1| hypothetical protein MIMGU_mgv1a025226mg [Erythra... 97 6e-21 gb|EYU31247.1| hypothetical protein MIMGU_mgv1a017756mg [Erythra... 97 6e-21 >ref|XP_012844836.1| PREDICTED: putative late blight resistance protein homolog R1C-3 [Erythranthe guttata] Length = 631 Score = 96.7 bits (239), Expect = 6e-21 Identities = 54/77 (70%), Positives = 60/77 (77%) Frame = +2 Query: 152 MDLLENPKLPHMLRRLNTKDFKKFNTFTWNGTHISAVVRFLQRSSRSTHHDNSIMDTLTR 331 MDLLENP+L H LRRLN+K FKKF TF WNG+H+SAVVR+LQRS S D SI L Sbjct: 1 MDLLENPELCHTLRRLNSKIFKKFYTFMWNGSHVSAVVRYLQRSRSS--GDISI-KLLES 57 Query: 332 LEASRNTTRFPRMVLSF 382 LEASRNT+RFP MVLSF Sbjct: 58 LEASRNTSRFPGMVLSF 74 >gb|EYU31552.1| hypothetical protein MIMGU_mgv1a025226mg [Erythranthe guttata] Length = 1038 Score = 96.7 bits (239), Expect = 6e-21 Identities = 54/77 (70%), Positives = 60/77 (77%) Frame = +2 Query: 152 MDLLENPKLPHMLRRLNTKDFKKFNTFTWNGTHISAVVRFLQRSSRSTHHDNSIMDTLTR 331 MDLLENP+L H LRRLN+K FKKF TF WNG+H+SAVVR+LQRS S D SI L Sbjct: 1 MDLLENPELCHTLRRLNSKIFKKFYTFMWNGSHVSAVVRYLQRSRSS--GDISI-KLLES 57 Query: 332 LEASRNTTRFPRMVLSF 382 LEASRNT+RFP MVLSF Sbjct: 58 LEASRNTSRFPGMVLSF 74 >gb|EYU31247.1| hypothetical protein MIMGU_mgv1a017756mg [Erythranthe guttata] Length = 1064 Score = 96.7 bits (239), Expect = 6e-21 Identities = 54/77 (70%), Positives = 60/77 (77%) Frame = +2 Query: 152 MDLLENPKLPHMLRRLNTKDFKKFNTFTWNGTHISAVVRFLQRSSRSTHHDNSIMDTLTR 331 MDLLENP+L H LRRLN+K FKKF TF WNG+H+SAVVR+LQRS S D SI L Sbjct: 1 MDLLENPELCHTLRRLNSKIFKKFYTFMWNGSHVSAVVRYLQRSRSS--GDISI-KLLES 57 Query: 332 LEASRNTTRFPRMVLSF 382 LEASRNT+RFP MVLSF Sbjct: 58 LEASRNTSRFPGMVLSF 74