BLASTX nr result
ID: Rehmannia27_contig00056910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00056910 (448 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001240040.1| uncharacterized protein LOC100787787 [Glycin... 77 7e-16 gb|ACU13843.1| unknown [Glycine max] 77 7e-16 ref|XP_012841887.1| PREDICTED: defensin-like protein 1 [Erythran... 67 4e-12 ref|XP_011086335.1| PREDICTED: defensin-like protein 1 [Sesamum ... 66 2e-11 gb|KYP69490.1| Defensin-like protein [Cajanus cajan] 62 2e-10 dbj|BAT79151.1| hypothetical protein VIGAN_02197400 [Vigna angul... 60 1e-09 ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutr... 60 2e-09 ref|XP_014492267.1| PREDICTED: defensin-like protein 1 [Vigna ra... 60 3e-09 ref|XP_013461623.1| low-molecular-weight cysteine-rich protein [... 58 8e-09 gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phase... 58 9e-09 ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phas... 58 9e-09 ref|XP_015937643.1| PREDICTED: defensin-like protein 1 [Arachis ... 58 1e-08 ref|XP_012848388.1| PREDICTED: defensin-like protein 1 [Erythran... 57 1e-08 gb|EPS66510.1| kunitz trypsin inhibitor protein, partial [Genlis... 57 2e-08 gb|KHN09675.1| Defensin-like protein, partial [Glycine soja] 57 3e-08 sp|Q07502.1|DEF_SOYBN RecName: Full=Defensin-like protein; AltNa... 57 4e-08 emb|CAA79164.1| seed-specific low molecular weight sulfur-rich p... 57 4e-08 gb|KRH54014.1| hypothetical protein GLYMA_06G160300 [Glycine max] 57 4e-08 ref|XP_015879652.1| PREDICTED: defensin-like protein 1 [Ziziphus... 56 5e-08 gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum] 56 5e-08 >ref|NP_001240040.1| uncharacterized protein LOC100787787 [Glycine max] gi|255647983|gb|ACU24448.1| unknown [Glycine max] Length = 90 Score = 77.0 bits (188), Expect = 7e-16 Identities = 37/49 (75%), Positives = 37/49 (75%) Frame = +3 Query: 177 QGLVQKQRLRKPRHLPPGKCSFLHTIRQLWSLQHCPLNPWLCDSHILPS 323 Q LVQKQR RKP HLPP K SFL T QLWSL H P NPWLCDSH LPS Sbjct: 5 QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPS 53 >gb|ACU13843.1| unknown [Glycine max] Length = 90 Score = 77.0 bits (188), Expect = 7e-16 Identities = 37/49 (75%), Positives = 37/49 (75%) Frame = +3 Query: 177 QGLVQKQRLRKPRHLPPGKCSFLHTIRQLWSLQHCPLNPWLCDSHILPS 323 Q LVQKQR RKP HLPP K SFL T QLWSL H P NPWLCDSH LPS Sbjct: 5 QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPS 53 >ref|XP_012841887.1| PREDICTED: defensin-like protein 1 [Erythranthe guttata] Length = 88 Score = 67.4 bits (163), Expect = 4e-12 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 I+KVE RMCE+QSHGFKGQCWS+HNCR+VC +E Sbjct: 35 IVKVEARMCETQSHGFKGQCWSEHNCRLVCAHE 67 >ref|XP_011086335.1| PREDICTED: defensin-like protein 1 [Sesamum indicum] Length = 92 Score = 65.9 bits (159), Expect = 2e-11 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = -1 Query: 358 TQEELGGN--ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNEHXXXXXXXXXXXXXXXX 185 T EE+G + I+K +GR C SQSHGF+GQCWS+ NCR+VCRNE Sbjct: 29 THEEVGFDSMIVKADGRTCLSQSHGFRGQCWSNTNCRLVCRNEGFPGGRCRGFRRRCFCV 88 Query: 184 RPCP 173 RPCP Sbjct: 89 RPCP 92 >gb|KYP69490.1| Defensin-like protein [Cajanus cajan] Length = 74 Score = 62.4 bits (150), Expect = 2e-10 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGFKG C SDHNC +VCRNE Sbjct: 22 VVQTEGRLCESQSHGFKGACTSDHNCALVCRNE 54 >dbj|BAT79151.1| hypothetical protein VIGAN_02197400 [Vigna angularis var. angularis] Length = 75 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGFKG C DHNC +VCRNE Sbjct: 23 VVQTEGRVCESQSHGFKGACTGDHNCALVCRNE 55 >ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum] gi|557090890|gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum] Length = 73 Score = 60.1 bits (144), Expect = 2e-09 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 I+ +EGRMC+S+SH FK CWSDHNC ++CRNE Sbjct: 21 IIGIEGRMCQSKSHHFKHMCWSDHNCAIICRNE 53 >ref|XP_014492267.1| PREDICTED: defensin-like protein 1 [Vigna radiata var. radiata] gi|951073813|ref|XP_014492268.1| PREDICTED: defensin-like protein 1 [Vigna radiata var. radiata] Length = 75 Score = 59.7 bits (143), Expect = 3e-09 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGFKG C DHNC +VCRNE Sbjct: 23 VVQTEGRVCESQSHGFKGPCNGDHNCALVCRNE 55 >ref|XP_013461623.1| low-molecular-weight cysteine-rich protein [Medicago truncatula] gi|657395301|gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula] Length = 52 Score = 57.8 bits (138), Expect = 8e-09 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 331 LKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 + E RMCESQSHGFKG C DHNC +VCRNE Sbjct: 1 MHAEARMCESQSHGFKGACVGDHNCALVCRNE 32 >gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus] Length = 73 Score = 58.2 bits (139), Expect = 9e-09 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ E R+CESQSHGFKG C DHNC +VCRNE Sbjct: 21 VVQTEARVCESQSHGFKGACTGDHNCALVCRNE 53 >ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris] gi|117575127|emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris] gi|561010903|gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris] Length = 73 Score = 58.2 bits (139), Expect = 9e-09 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ E R+CESQSHGFKG C DHNC +VCRNE Sbjct: 21 VVQTEARVCESQSHGFKGACTGDHNCALVCRNE 53 >ref|XP_015937643.1| PREDICTED: defensin-like protein 1 [Arachis duranensis] Length = 76 Score = 58.2 bits (139), Expect = 1e-08 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 ++ EGR+C+S+SH FKG CW DHNC +VCRNE Sbjct: 24 VVHTEGRVCQSKSHMFKGGCWGDHNCALVCRNE 56 >ref|XP_012848388.1| PREDICTED: defensin-like protein 1 [Erythranthe guttata] Length = 51 Score = 57.4 bits (137), Expect = 1e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 322 EGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 E R CESQSHGFKG+C SDHNC MVC+NE Sbjct: 3 EARTCESQSHGFKGRCLSDHNCGMVCKNE 31 >gb|EPS66510.1| kunitz trypsin inhibitor protein, partial [Genlisea aurea] Length = 66 Score = 57.4 bits (137), Expect = 2e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -1 Query: 322 EGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 E R CESQSHGFKG+C SDHNC +VCRNE Sbjct: 18 EARTCESQSHGFKGRCLSDHNCGLVCRNE 46 >gb|KHN09675.1| Defensin-like protein, partial [Glycine soja] Length = 59 Score = 56.6 bits (135), Expect = 3e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGF G C DHNC +VCRNE Sbjct: 7 VVQTEGRVCESQSHGFHGLCNRDHNCALVCRNE 39 >sp|Q07502.1|DEF_SOYBN RecName: Full=Defensin-like protein; AltName: Full=8.4 kDa sulfur-rich protein; AltName: Full=Probable proteinase inhibitor P322; AltName: Full=Protein SE60; Flags: Precursor gi|18748|emb|CAA78359.1| a protein similar to potato tuber protein p322 homolgous to Bowman-Birk Proteinase Inhibitor [Glycine max] Length = 74 Score = 56.6 bits (135), Expect = 4e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGF G C DHNC +VCRNE Sbjct: 23 VVQTEGRVCESQSHGFHGLCNRDHNCALVCRNE 55 >emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine max] Length = 75 Score = 56.6 bits (135), Expect = 4e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGF G C DHNC +VCRNE Sbjct: 23 VVQTEGRVCESQSHGFHGLCNRDHNCALVCRNE 55 >gb|KRH54014.1| hypothetical protein GLYMA_06G160300 [Glycine max] Length = 76 Score = 56.6 bits (135), Expect = 4e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 +++ EGR+CESQSHGF G C DHNC +VCRNE Sbjct: 24 VVQTEGRVCESQSHGFHGLCNRDHNCALVCRNE 56 >ref|XP_015879652.1| PREDICTED: defensin-like protein 1 [Ziziphus jujuba] Length = 75 Score = 56.2 bits (134), Expect = 5e-08 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -1 Query: 334 ILKVEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 ++ EGR+C+SQSHG+KG C DHNC +VCRNE Sbjct: 23 VVPSEGRVCQSQSHGYKGPCLRDHNCALVCRNE 55 >gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum] Length = 75 Score = 56.2 bits (134), Expect = 5e-08 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 325 VEGRMCESQSHGFKGQCWSDHNCRMVCRNE 236 VEGR+CES+SH FKG C SDHNC +VCRNE Sbjct: 26 VEGRICESKSHRFKGVCLSDHNCGLVCRNE 55